Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001682*

Transcript Name: zgc:162948pa
Type: Promoter
Genomic Location: chr4:61272157-61278332
Nearest Gene: zgc:162948 (NM_001082919)


zgc:162948pa
Exons
6127215761278332







*A ribosome profiling study carried out by Pauli et. al. (2013) suggests this proposed lncRNA could have coding potential.

Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 1.32 1.83 1.7 1.74 1.67 1.31 1.47 1.1 1.13 1.79 1.36 1.49 1.4 1.54 1.39



Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 50-85 MMFFRHLKCINR
2. 99-140 MWSLYILAVINVIL
3. 483-551 MIELHDMLRYPAGSNNHATFKVS
4. 578-622 MLTVLQQILFTMSTC
5. 496-642 MTCCVILLEVTTMPRSKSLKSPFLPHSDAHSTAADPLHHVYLLKCSELH
6. 801-836 MSPCTAFRHISL
7. 769-900 MLLMMVVERVSCLHVQLSDISVYKTAAFHLPSVSARDLSTEESS
8. 809-937 MYSFQTYQSIKQQLFISRQFQHVIYLQKSRAENEEIRKTSCSF
9. 906-956 MRKSGKHLAHFKAREFL
10. 1124-1234 MAFIKEESEDLKIEQVFTLKKEEPEELTGWLSFSKIS
11. 1237-1314 MISWIRNTLNEEVFRKTLIIIIGHIS
12. 1338-1376 MLMTSVGEITLEM
13. 1334-1552 MHAYDQCWGDYFGNVKYYKLYIYIYIYIYIYIYIYIYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSC
14. 1585-1617 MFGLPYSFANA
15. 1613-1699 MLENQFYCKLLNMQYSAHIQLKSEFSAPL
16. 1817-1855 MQLNNQIMVQAFH
17. 2370-2408 MLFKQLKSAFILA
18. 2667-2726 MDEPFSIWRRENRTDAGDVV
19. 2710-2892 MRAMLCKGEGGFKVTQSTDSGTHSTPRCHTCLEEVRGEPSTVISPYLLTVEGVPMSQISAL
20. 2946-2987 MSNSIPGGPQPCTV
21. 3257-3346 MLNKSGPIPKSGGHHDTEGRPTICALPKYS
22. 3300-3410 MTQRDGPRSVPFPNTVDIRSLHMEVCLMVNHTERLLF
23. 3701-3733 MATPKHSLCCP
24. 3664-3744 MTFSIGLRSGLCDGHSKTFTLLSLKHM
25. 3762-3809 MPRLMICLEEPFVAKL
26. 3931-3972 MMLPPPYCTVGMVF
27. 3834-4007 MLLQYFSIMFCLHDAIYAVKWTSPSCSKTAPQHDAAAPILHSWDGVLGLSAFPFVLHM
28. 4056-4091 MSPNIHQIRHLP
29. 4153-4206 MLSSGPPVLQHTYTSDTR
30. 4206-4235 MTLEYPVGRV
31. 4304-4375 MNTTLGALHCSRILQVRSSSCGLY
32. 4273-4389 MLMLFWCVYTDEYYIRSSTLQQDSAGTLLLMWFILDLKP
33. 4637-4738 MPKKDPTPALSVGRASSRVKASPRTRSSTPERCP
34. 4869-4997 MCPHQNSHRRKALQVLAVWKVFHPEVSPCLAQDSSHRRETLQL
35. 5079-5108 MWPVRKGFPQ
36. 4405-5178 MLSSAAVCSYTDVICVVELKPPKVEDEEEEEFDLMTIVESIRAERTAERDETASIFTCQECGTSFSEKRDFDAHIADHAKERPYTCSQCGKGFIQSQSLATHKKFHTGEMSLTCKVCGKSFTSIYNLKSHLRTHTRERPYKCSHCGKAFMSSGARCAHIRIHTGEKPFKCSLCGRSFTQRSALASHKTVHTGEKPFSCKACGKSFTAKRYLQRHVKLHTRVQPFTCGRCGKGFLNKSSYQHHMEERPFPCGQSEEFLR
37. 5178-5207 MRSASGTGQL
38. 5294-5341 MNVESQTEDVVENPFR
39. 5319-5384 MWWRTRSDDELLYGLVVQVPNH
40. 5341-5469 MMNFCMDWWSKSLTIRRQPETHNYHATIRQLYDRAAQTEDTPP
41. 5414-5479 MQPSGSCMIERPRRKTLLLKGV
42. 5624-5680 MVVLASCCGDVFQQQELED
43. 5652-5732 MCFSSRNWKTSQDRGKDECSDVQRHPE
44. 5732-5827 MKTCTRVLSTSDWGDASSSSRTMTQSTAPTYQ
45. 5641-5877 MLWGCVSAAGTGRLVRIEGKMNAAMYRDILNEDLHKSALHLRLGRRFILQQDNDPKHSANISMKRLHNNLLSGPARVQT
46. 5913-6080 MSPSLIIRPDRAGVVLHRGFKSVFCRSVLWAESLGSCFILRKLKKGETCCVYFTPA
47. 6080-6163 MTVDTLHYTHFCPHMFILHHKSPLIKTC

Variant Information


Variant PositionrsIDReferenceAlternate

No variation reported in dbSNP within this genomic loci


References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: