Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001681*

Transcript Name: lnc_zgc:92791
Type: lincRNA
Genomic Location: chr4:61239877-61241810
Nearest Gene: zgc:92791 (NM_001002543)


lnc_zgc:92791
Exons
6123987761241810





*A ribosome profiling study carried out by Pauli et. al. (2013) suggests this proposed lncRNA could have coding potential.

Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 1.01 1.66 1.92 1.97 1.91 1.6 1.91 1.34 1.61 0.84 1.85 1.82 1.58 1.41 1.44



Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 192-272 MWSVWEELLEKGLSSLSHENSHRRAAV
2. 276-362 MWSVWKGFQRKNKLQLPHDHTHQGEILTM
3. 447-503 MWEDFQSERELESPQRSAH
4. 37-591 MTIVDSIRAENINAEREESKKNLSCQQCGLSFTSLHDLESHLSTHSNRQPFICGQCGKNFSRKDYLLCHMKIHTGEQPFKCGQCGKGFNAKTNYNYHMTIHIKEKSLPCDQCGKRFSHELSLNHHMRAHLNSFPCKLCGKTFNRKESLKAHSAVHTKEHSFVCAQCGKSYTHKSSLGKHEKVHKS
5. 572-613 MRRFINHKCGRLCG
6. 693-749 MFSRSWRRFPLGALVNFHC
7. 808-840 MGKGRCSHNWE
8. 922-987 MFVGMKDMQTMFVTTQLVMFVG
9. 1141-1176 MECNSVSHVFMV
10. 1208-1270 MRCYVIKITGTGIEFKVYKGL
11. 1218-1292 MSLKSLELVLNLRYIKVFERYSALG
12. 1417-1479 MDVQRSLRQRSMARGEMVKPN
13. 1648-1692 MGVGCSTKEAKDHGL
14. 1580-1705 MCNLAGPCHPICSELELNQRPSAWESVALPRRLKTMASSICP
15. 1783-1890 MDSVYWNFCVQLLRHNLQCKRILLNDLIIQETYLFS
16. 1894-1932 MSMNKGINLGASF

Variant Information


Variant PositionrsIDReferenceAlternate

No variation reported in dbSNP within this genomic loci


References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: