Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001669*

Transcript Name: lnc2_ptprb
Type: lincRNA
Genomic Location: chr4:59722445-59738932
Nearest Gene: ptprb (NM_001199134)


lnc2_ptprb
Exons
5972244559738932








*A ribosome profiling study carried out by Pauli et. al. (2013) suggests this proposed lncRNA could have coding potential.

Expression Information

Negligible Expression across RNA-Seq datasets





Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 215-289 MKTMEIYNKRCIIRQRWLGLASMRT
2. 381-455 MWFDPGRQLERLELQYTISICLLTW
3. 262-471 MAWIGLYEDINSWRWSYRNMKIVFSTWSAEEPNNFNGKEACGLTQDGNWNDWNCSILFPFVCLHGKECTI
4. 452-571 MVRNAPFSEQRLMLKKITEIENKLVVVLLAGLIIVSYSSL
5. 656-709 MYIVEFDVYDATLHFIIL
6. 675-800 MYMMRLCISLFCKKKKFAFTFHNPHFLKRLFFWSHGMPLKPS
7. 890-943 MSHLGQKYQFLTAELSII
8. 990-1034 MVGISVFFRMEIADL
9. 1235-1345 MQGYQSFRVGISVFLGWSYQSFRIGISVFFRAELLVI
10. 1613-1786 MVGYNFLGRGYRFFRAELSVIKGRDISSFGRSCQLFRVELSVIKSGDISFFRVELSVI
11. 2475-2624 MVGYNFLGRGYRFFRVELSVIKGRDISSLGRSCQSFRVELSVIKDGAISH
12. 2740-2823 MVGYNFLGRGYQFFRVELSVIKDGAISH
13. 3642-3677 MYEIMHCSTFFL
14. 3646-3711 MKSCTALHFFYNFRIVLSGCNS
15. 3702-3764 MQFIIANNLNFCSMATLKKKI
16. 3803-3850 MLKGANESSETHLVQK
17. 3819-3857 MKVLKHTWCKNEI
18. 3850-3912 MKSDLMNSYYRKWNRPVRFYQ
19. 3885-4004 MEQTGSFLSVMQRPGRTLRVTVGNITQTWPSFRINLRIRW
20. 4066-4113 MVRWYKCLHFLLCLAG
21. 4074-4127 MVQMSPLPPLPGRVNNQK
22. 4016-4237 MKPYSSAWIGLFRDTWKWSDGTNVSTSSFAWPGKQPKMNTLQIPCGVSDSGGLTSYQICSSALPFLCILRKFDF
23. 4338-4514 MFRNIAKMPAFIFYSHLNSKYVHTAGKISIGHVMVFPGNNISKGAVDMEWNLILQTIQT
24. 4484-4636 MEPDFTNNTNIICNNNEKKSTKLLKINLILYIKGFLVTPAEKSCLNQPRLV
25. 4797-4838 MSSSNQAGLAVFPA
26. 4885-4923 MAKTLLKPAWSTS
27. 4863-4952 MAGNQPGNGQNPSKTSLVDQLKPANQPRLV
28. 5000-5032 MENEVSCIAQV
29. 5017-5100 MHCSGVSFSQTSTECQNLDGSLGLVCQI
30. 5007-5111 MKSHALLRCEFLTDFNRVSKSGWFFGARLSNLSLF
31. 5072-5188 MVLWGSSVKSELILVFSIGFGSGDWLGHSTARSSFSEFP
32. 5220-5252 MSTLVSSSSSC
33. 5305-5358 MWLSADKYGPIGAFCAYW
34. 5390-5620 MVNQLYETYPRVNRLTYPPPSLNPSVFLKHHQKQIIYLFGFCLACFLKPFLTKMASLSTPHHVTSLPTYTVSHWKNW
35. 5692-5859 MQTESAEYLYYLLNFLLIIFNNIYPNTKPNRHSNVKTGVFSISIADKSCGWMIIAF
36. 5835-5909 MRMDDNSLLSLPVGTEGPYWPIFIT
37. 6032-6109 MSFYNSLSSCVQYFFPASFHFITLHL
38. 6058-6240 MRSILFPCVISFHYTSFVNELNLFSFHIYISLVFTSIWGKFQVNSTFSKMFSEKTGDMLNI
39. 6258-6308 MWPFLNTFKNSRHFSEL
40. 6313-6420 MFQNPFVLGTTFFRHSFTSAADVRTAEAVTNSPTSL
41. 6437-6475 MILCMSKVNSLGS
42. 6497-6574 MPYIYRDIFLQCYSLQYFSVAIGISQ
43. 6492-6590 MKCHTSTEISSYSVTVYSISLLQSGFHNNLPQK
44. 6706-6780 MQVNLYKYSTTTYKRERESDRPTSL
45. 6850-6879 MTKQQILLTF
46. 6909-6974 MPSVYRDFSPDCCCVCDKEGRG
47. 6904-7011 MKCHLSTEISHQTAVVFAIRRDEAESSFLLTLSGPP
48. 7084-7170 MRFWRHLVDRRHQLSLAADELSEIVNILK
49. 7462-7497 MMVCSVDYRKQI
50. 7531-7569 MVFKKLKTAFILA
51. 7818-7856 MCVVFYQVQRNRL
52. 7865-7963 MVKNIQNRNDPAAMEGIVDWVSVKGSRNTKTHV
53. 7959-8030 MFELLTVVFVSHTAKNTIRTPIFH
54. 8208-8324 MSKAWFKPISALYCATSLIFITVTVFRRQRRHVVLAKQA
55. 8653-8685 MLAPQPNCNLV
56. 8770-8895 MLRFFFSHSPCGIKHCMKNTRLEQFLKSNISFVARGMNEFPE
57. 8882-8929 MNSLNERAKLQLKSTI
58. 9442-9498 MTLDAFGCSEIGFWPPSCV
59. 9452-9502 MHSDVQRSVSGLLHVCK
60. 9462-9515 MFRDRFLASFMCVNKSEM
61. 9521-9580 MRLSCKQADRFIEAFRFVRR
62. 9615-9668 MTKKEEHVWGRQRGKRQM
63. 9634-9678 MCGDANAVNDRCNRG
64. 9881-9919 MRDVRNCMARVNA
65. 9757-9975 MTALSLHLKILLKNVIFRRAKSKTISSIVASVVQMLEPAFTHARRQKLYGKSKRMNWIWVTIKRTCEQANNLR
66. 10147-10188 MAERTKWSVCMYFS
67. 10164-10199 MVSMYVFQLSAH
68. 10136-10276 MEQRWQREPNGQYVCISAECTLTMLVETSSFLVKAAALQDSSLRCMI
69. 10364-10417 MLLRYLTNRLMIIINYAY
70. 10712-10792 MSYRCVLRINQLESHLPFPLRASCVAS
71. 10827-10865 MLVEKLSISLANS
72. 10916-10954 MRDNGSTFAFALG
73. 10926-10994 MDLLSLSLLDRETFTHRRQLVYK
74. 11076-11108 MNNNNKVCSKT
75. 11163-11210 MDIINNTANINNIIQK
76. 11220-11258 MNELKKPPEMKKT
77. 11302-11469 MFCNILILYIYILYLFLLYPIYILNIFIFSYVKIFAYCSLVCIKQCVSEAQLCAGV
78. 11577-11612 MCAQMSANAFAI
79. 11599-11652 MHLLFKQRLKTTLAPSLN
80. 12096-12245 MIAVRYFASNITQRPLHPSPLCITPPTYSQQQKDATVSQLLLLLDDKRYL
81. 12290-12358 MQFIYNYSAYFKIFTISERVGDG
82. 12379-12429 MVTEPHYKPLCLEDITV
83. 12408-12530 MLGRYNSLISNNYSLIKHSQHINLDNCEHIFNISKKYSQRL
84. 12553-12615 MNRLACTSCRRDHEAVFALSL
85. 12777-12809 MDSQPICQQIR
86. 12755-12841 MARELPRNGFPTHLSTNQVNPAWLCKKIN
87. 12820-13011 MALQEDQLMEITIGAVRLSRISRVCTSLLFPMEVRGNELTASHVTRIDRSHTPKMDNFIICSPQ
88. 13079-13132 MQVVNCNTLSISFHYTPV
89. 13158-13265 MSKRDNLKANSLRFLVTNGLLMFLYFTSGYYLCVNI
90. 13354-13440 MWRGLTIFSRDKGVSGKKKVGNHSGPARP
91. 13334-13537 MSDYIIKCGGGSQYFPGIKGSQAKKRLGTTQGQRVHRGDIVGRLGRQNRDGGVRNTTLTTRALSYIRV
92. 13568-13624 MILPSPPVPSNISASRGVE
93. 14683-14739 MILPSPPVPSNISASRGVE
94. 15127-15183 MTLPSPPAPLVISTSSVVE
95. 15416-15448 MRDQPQIIIST
96. 15453-15500 MTQKRLQDHQKLFTST
97. 15595-15636 MDTLTKNTARLQIS
98. 15582-15656 MWKPNGHLDQKYSKTANQLTTVLFN
99. 15729-15812 MLFRDQGRLNALSGHKIQCKFVNCNRSF
100. 15843-15902 MGIRVWMSNGHQGFDIKVIF
101. 15868-15906 MDIKVLTSKSFFK
102. 15934-15963 MKVQAWKCRH
103. 16000-16161 MPDSLLQISQMLKKWGLETQTKVTLRIQPDGNVFTLFKKPCKQNMCQSEAAEHC
104. 16041-16211 MGSRNANKSDVENSARRKRLHTFQETMQTKHVSVRSCRALLTHRRVQLCPCKVNNMS
105. 16250-16312 MTNMFCLLFCSIILTYGLMIM
106. 16369-16404 MSTHVTWTVREH

Variant Information


Variant PositionrsIDReferenceAlternate

No variation reported in dbSNP within the exonic region of the transcript



References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: