Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001668

Transcript Name: lnc1_ptprb
Type: lincRNA
Genomic Location: chr4:59660482-59661533
Nearest Gene: ptprb (NM_001199134)


lnc1_ptprb
Exons
5966048259661533



Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 0.41 0 1.86 1.78 1.58 2.32 2.25 2.06 1.58 2.91 1.33 0.83 0.82 0 0



Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 161-205 MILYILLMLLFYGKV
2. 437-514 MEIYSVSFQIQVHIQIVLNVISCIVL
3. 492-590 MLSVALFCNDIKVPVTMIKVKIMMLCSKITTTF
4. 639-701 MYFFILPMLSQFRIKLKSMLM
5. 716-775 MTCNLFDQVLKTWDDCSKAN
6. 756-818 MTAPKQIETSFLEPTEVTTSF
7. 843-875 MCNSFLMVGMK
8. 959-1003 MYILLQKYHFLLFLL

Variant Information


Variant PositionrsIDReferenceAlternate

No variation reported in dbSNP within this genomic loci


References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: