Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001664*

Transcript Name: edal62
Type: lincRNA
Genomic Location: chr4:58941464-58950027
Nearest Gene: zgc:171551 (NM_001113638)


edal62
Exons
5894146458950027









*A ribosome profiling study carried out by Pauli et. al. (2013) suggests this proposed lncRNA could have coding potential.

Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 3.85 3.18 2.64 2.36 1.95 1.4 0.92 0.33 0.06 2.64 0.72 1.59 0.32 0.68 1.73



Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 27-77 MDCAGLLNCSALSSKTS
2. 107-169 MCLLKYKLMVSQLMLSVVFCV
3. 172-210 MFLSLKCFTCCGR
4. 189-227 MLYLLWSLTDNEV
5. 220-315 MKCELLFLCSSAESLSVFLNLLSSSVCFSALS
6. 403-471 MVLHLLTPAEKSCLNQPRTVGWF
7. 640-669 MTSKIQLNPA
8. 800-835 MAGNPSKTSQQA
9. 962-1024 MSSLKQDGLAGFSWSVSSLTS
10. 1041-1196 MAGNQPGRGQKPSKTRLVDQLKPANHTRLVKTGFFSRDLITDFTIMDFIFLY
11. 1302-1346 MTIKVQHCSQSKKQC
12. 1349-1393 MLFSSHTCRLFQTEY
13. 1566-1706 MAFIKEESEDVKIAETFTVKQEDPEEQTGWFLFSARSLGSFLKSNKF
14. 1730-1765 MLSLPMVDKNST
15. 1769-1807 MLHKKRQRAKKKP
16. 1896-1997 MPNRARQHGYCFNVLQPSFERYTKHISSFLGNAM
17. 2016-2096 MQITNHKLRFCHKTNVFVLFSQYTQAI
18. 2059-2133 MYLFYFHNIPRQYKTDIYIYIYIYI
19. 2215-2244 MLNFDYRIKK
20. 2272-2364 MSRQLGLPSGKKTGLLKCLLNCRSRRPVDRA
21. 2256-2384 MLPRPHVTSAWLAKREKNRLVEVPVKLQKQETRRQSLNPLLFQ
22. 2427-2651 MLTTFVLSTKKHSFASSAMYVLRTVRPIDNTGIAILRPHPLQIRSRKVHTQALFTLSLLLNGILERQRFDIHSGV
23. 2737-2934 MCSRQQVQAVRGLLQSFTHLYLVILANTSDTVGWFLLVVRLFYRRHYNDTDHCQFTSPAEKVIDRW
24. 2940-2972 MCVSCLYSFTV
25. 2983-3012 MGKTKTMQVR
26. 2972-3058 MICLWVKQRPCRSGSLNSRLQIINWSLIN
27. 3298-3363 MYLSNISTRTASLPFVYYSAHM
28. 3497-3565 MFDFVFIYTIMPSNCCINAISHS
29. 3578-3631 MAVYRHWWGHKAAFHQCQ
30. 3625-3660 MPINSHIALLLV
31. 3549-3674 MQYHTRSSAIWLYIGTGGGTRPPSTNANKQPYRTATRVILLI
32. 3743-3808 MNKRLFLVPQGKQINHATLIHT
33. 3808-3858 MSLSTAHNRRQTNGYSH
34. 3845-3916 MVIHTEINSSISALIHMRLMDTCS
35. 4073-4159 MVNYLNITAFIQRFIVFPLFKIYTLHKTL
36. 4167-4244 MLHTINKTDFNTNFSKQTPLMCLFLY
37. 4249-4308 MFMVMFTFTVSFRETPEVNN
38. 4345-4488 MLRFPPPVAMTSWTSRASSVLKSASVHPRYQEHIREVSRVLRTCGLEY
39. 4511-4555 MMTLHEDTRPLKNAY
40. 4626-4664 MMYNRARKLSPYV
41. 4855-4899 MSSKLLFTVVMAKMK
42. 5117-5155 MIIVFSFFFVCCC
43. 5186-5239 MCVQEKRSGEVCLQCQKS
44. 5227-5379 MSKIVTIYWIQMNISMTELWVTLRQCNTRITFKRFATNIHFLTPAYIHHRS
45. 5301-5399 MQYKNYIQEVRNQHTFPDSSIYTPPILTCGVLV
46. 5384-5608 MWSFGVTSLVSHCSVLHWPHLRHTSSFSMNSLPNNKVYIFLCSVFSFNTFLQTGSFCRAEFNFGPASIYFCKNAN
47. 5601-5636 MLISMHSTHTQQ
48. 5666-5890 MTNTNNCLIKRKRDKIIKKLIAILQHILILLYSVNIIVCVCVCVCVCVCVCVCVCVCVCVCVCIYIYIYIYIYIH
49. 5991-6029 MMTFHDVLARMYT
50. 6087-6125 MPFWIFHLLRRHD
51. 6139-6177 MDICDPVIVLNRQ
52. 6196-6258 MQGKFIYTAHFIHRGNSKCFT
53. 6296-6325 MQTIKIIKMS
54. 6388-6429 MIVQSVGRSTVLIQ
55. 6366-6512 MEKENEKHDSAICRTQHSAHSVKAQLNGCVFSLDLNVPNVGAHLIISGS
56. 6757-6864 MCSDFLVLVRILAAAFWMSCKCLTVFLGRPVRRLLQ
57. 7146-7670 MQEFPVILGDQLQFCSFNFTHKHFIHAPVTNWNIRRKLGVRTGESVMEFINACRMERKKLLYFTKNHGLGLHSVRGYALDWPTHSPEMNIIEHVWGKMKEEALKMNPKNLDELRESCKNAFFAFLIYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQTHNSVSCQNKLLF
58. 7477-7680 MNSGSPARTLSLPFSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYKHITVYHVKTNFYFECD
59. 7649-7714 MSKQTFILNVINFCPVIIYICF
60. 7708-7776 MFLTEKLKAPPFCRLFQGSMCVS
61. 8177-8302 MHRPKPVRGRRTSPQSTRKTQAFHILPALPLPFLPVYYTSSG
62. 7788-8309 MCLGIEEYFPNAHCWVHPDATLLQSLHKHVKPFVKLLRPTLVVLHMGTHDISSRASSLSVVYRMKALTARISQANPNVQFFAISAVLPRPRDDCVTKATVKQTNRMMQRWTTYERNMLFLNTSKYYLKYRCIDQSLYEDDGLHLNQRGKPKLFIYFRRFLFHFCRYTIHPQVRV
63. 8345-8392 MSFDILCVFDLFIMYM
64. 8426-8455 MHAWVYFIYT
65. 8395-8472 MHRNEAVSQIYACLGVFYIYIMNIHT
66. 8430-8516 MPGCILYIHNEYTHLICQTFILDVFFLYF
67. 8497-8535 MCFFSIFNADYNF

Variant Information


Variant PositionrsIDReferenceAlternate
58941782 rs41240480 G A

References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: