Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001649

Transcript Name: lnc_zgc:174696
Type: lincRNA
Genomic Location: chr4:41728930-41732286
Nearest Gene: zgc:174696 (NM_001114884)


lnc_zgc:174696
Exons
4172893041732286





Expression Information

Negligible Expression across RNA-Seq datasets





Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 5-43 MLFLQKLSTVGFT
2. 199-228 MVAFSGKSIL
3. 134-331 MGGAPEQNRRQTNVQSTLRRRRWWLFQVRVFYNSLLLNIARKSVHRMMLFYVISVFQSLLSFSIFS
4. 478-546 MCYTAILTVDRGKVGFIFAHSVI
5. 652-684 MLYFDSHWLQI
6. 748-897 MCKYKTNFTSVQANENTGLHPNVTLAKFKCHVCSCSNIESEIFLVTCITT
7. 834-974 MPCVFLQQYRVRNIFSNMHNHLRNSDTVPCMKAIFTIILCLKSTDCC
8. 1014-1079 MSKLDSYSSKLASISRREGGIA
9. 1318-1356 MNKCANIKPTLPL
10. 1326-1409 MCEYKTNFTSIGIADRDNIGFIFAHSII
11. 1517-1549 MLYFDSHLMLI
12. 1610-1648 MSLYPSIKPTLSL
13. 1788-1829 MMESLHSRSIFSVS
14. 1715-1852 MMLVNNFHFSMVFFHCLYLMSLLQNDGELAFSEHFLCILMKIMKTS
15. 1852-1884 MKKYTVSVFKH
16. 1888-1917 MFKVPPHKFT
17. 2171-2209 MANTLIYNLHRQT
18. 2290-2322 MSPRLVLFFWE
19. 2451-2480 MKEIEEEAFL
20. 2519-2548 MLSLLMAPKF
21. 2552-2602 MKFCNFKWLNGLVIYKD
22. 2580-2615 MVWLFTKIRGQF
23. 2633-2662 MARTISDIQN
24. 2572-2757 MAKWFGYLQRLEVSFNLFFTNGSNDFRYPKLNPVAVCVMLPALNFAFRFPSKMYYLQLHIVK
25. 2998-3093 MFTIDQSVFKKKNPLQTAISTVCGCLQKSRPV
26. 3069-3131 MFTKIEASLNVTLTILCKDQK
27. 3159-3197 MYLIFQIKIISNS
28. 3230-3304 MFTVNPLFLCICFKGPVKLKLFYGF
29. 3297-3338 MDFRCCMLQNLAKK

Variant Information


Variant PositionrsIDReferenceAlternate

No variation reported in dbSNP within this genomic loci


References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: