Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001637

Transcript Name: lnc_si:dkey-13e3.1
Type: lincRNA
Genomic Location: chr4:28564930-28567193
Nearest Gene: si:dkey-13e3.1 (NM_001113341)


lnc_si:dkey-13e3.1
Exons
2856493028567193





Expression Information

Negligible Expression across RNA-Seq datasets





Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 56-103 MVSHTFICMFFSYKYL
2. 194-247 MVCLQGCYGNGEPQECHY
3. 138-257 MIHLKLYLNIMSGEWVGPGWFVYRVAMVTVNRRSVITRAP
4. 338-382 MLLKCVYKFSEVTCS
5. 430-573 MKTAVSGRLCYMITAKLTKGLHHAEILCKRYVFVFKLLKTIIISLLIV
6. 747-797 MLICKAFKGRVCNVSIL
7. 1006-1062 MLVNLSNFKACQAHLFNSF
8. 1212-1262 MTFFICTASELLSSILL
9. 1289-1327 MYSILCSELDYCT
10. 1485-1523 MNILIVYLRIKFL
11. 1533-1592 MDPFHKKVMMCLMVISILNL
12. 1628-1711 MSTVRQNTKKKKDCLCQVFLMQCLWAGQ
13. 1672-1899 MSGVSNAVPMGRTVNLMLFSPLVAIISLTQLLLLLFFFAFSESIDNTITEFSFGYWSKIKCKHFVVFCHKYDYFCY
14. 1883-1936 MITSATKQPRIVKRVHRT
15. 2046-2117 MVKKVKRQRWWAPRKGQNSEGTYF
16. 2072-2173 MVGAKEGPKLRRDLLLINFLELKNCVFFCVFIHV

Variant Information


Variant PositionrsIDReferenceAlternate

No variation reported in dbSNP within this genomic loci


References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: