Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001630

Transcript Name: lnc2_tprkb
Type: lincRNA
Genomic Location: chr4:27674698-27680939
Nearest Gene: tprkb (NM_001007373)


lnc2_tprkb
Exons
2767469827680939








Expression Information

Negligible Expression across RNA-Seq datasets





Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 21-50 MKGFDLEKQL
2. 439-570 MLFKTTNTSLYIYLFSNRIKPVQSEKNGRCFSRHDYCRDAQRGL
3. 622-726 MEPNHTATPHLLQYSHQTGEHAAHRFVCVLFDLFS
4. 518-760 MGDVSADMITVEMLREACETVRCSPMDVIKTPMIPWSQTTLPLHTSCNIHIKLENMQRTGLFVSCLTCFLKQTGSFNKIQG
5. 772-807 MLTFFIYSADHF
6. 934-975 MENDKLLMCRSIWL
7. 969-998 MAVKFTVILE
8. 1210-1257 MHSEVINLNCLTLGDW
9. 1262-1294 MKKSVSLKFLS
10. 1416-1469 MGKLFHTHASIMDPKAKW
11. 1400-1567 MSAGNYGKAFSYACKHYGSKGKVVMPETAPISRSVLIQVRQSFIYTLQLHLPGFLC
12. 1438-1578 MQALWIQRQSGDARNCSHLQICAYTSTPIIYIHFAVALTRFPLLILQ
13. 1585-1653 MCQMFRIWELRLKESQLLSSWVL
14. 1702-1734 MILTSSLDIPG
15. 1644-1787 MGVVNRCVQEDGMTFLHSIDDPDLIAGHSRLRSCVVSKNCLLVKMISN
16. 1842-1928 MTFDHQNNDKNKNIIIEEKVYSFESFSSK
17. 2042-2074 MSIYFDNNAVN
18. 2210-2251 MEGSPKTENSLIVW
19. 2320-2433 MLEKKKQTLTLIVYFVPTIDVNGFCFPAFFRISFFVCV
20. 2378-2464 MSMASVFQHSSEYLFLCVFKNNYLTVSKC
21. 2555-2593 MFFFFFTLTVLVL
22. 2530-2670 MHLITHHSNVFFFFYSDCAGAVVLKLFSKMYITVHFETAFDPFFAIY
23. 2729-2914 MSYPIQMWWLFAVVVEGYFLVWPLPSNCLVVKTQRSMELNQKEVNHQNLFLYFVCLPEIVDV
24. 2910-2942 MCENLPVNLNE
25. 2942-2989 MNQVQFLVKEIKPDVS
26. 2982-3035 MFHKPLHNWKDNLCQTGY
27. 2938-3051 MNESSAVPCEGDQARCFISLYITGKTTFAKLATSCLKP
28. 3132-3188 MCFSALLRPRVMSFLTAKV
29. 3252-3311 MHLCRLECKTFFAKCQKSAE
30. 3526-3588 MLHILKRRKAINCCMNAVMFK
31. 3607-3687 MHEGHVTIRNNAATHFSEDVFCVLAVS
32. 3638-3700 MQQLTSQRTCSVFSRSPEFVL
33. 3859-3906 MLFQLYITVCGGFLSP
34. 3771-3956 MGISKKQSKKRTEFPNKTTRSGFLKILLEDVVPTVHYCMWWFPVPLMIGTRTGSNVCGSSIL
35. 3934-4062 MSAGPAFCSSAFRQLMTSLKDVSVVQPRLQPFQKQDSKYSGRS
36. 4164-4265 MAMLLLADISNLMFIVTVGAIYGLQFSFAPLEGV
37. 4333-4362 MDVRIGLYLF
38. 4393-4530 MDNKWIGISNFISKRYGHFTLLLTRLSNKRVRTNDQNICTYSDIGG
39. 4404-4553 MDWNIQLYFQKVWTFHFIIDPFKQQTCQNQRPKYMHLQRHWRVNCLPWCP
40. 4553-4615 MIKDLESDMMTALSWLLWRWD
41. 4739-4849 MPPDRTSVAHRFPGAVGSIHLHRFRSVAETHAGLHRF
42. 4869-4967 MLVRRDSTDKVVHINHLGGICFRACLSLLLICY
43. 4928-4981 MLSCMSQLAPYLLLAPCS
44. 5148-5255 MLFPVQGQGRCGAGLTCCATVAQLDVGFRTRTAPLW
45. 5177-5326 MWSRSYLLCHCGPTGRGFPNSHCPSLVNSSSSGTVHPHPEFWNLHVWSID
46. 4975-5337 MQLMHSHAVQLILEHFGEAQVNLSASSETVHFQLFYCLTKTPSAWMSWISCDPGACTICFFLFKVREDVEQVLLVVPLWPNWTWVSELALPLFGEFLILRDGASSPRILEPPCVVHRLIDR
47. 5365-5538 MPSWDLSVVLAGLQKILFEPLDSILRNFVIFCCFNVLIFLLGLTLFSFGYFCSMCTWQ
48. 5746-5790 MSCNVTFAPLTYTIS
49. 5822-5920 MYKSFIEKRPVGMDAKSIASGLAPPFAGMKSTL
50. 5981-6046 MIYFQECLRISFVRGMWRRLCW
51. 6143-6181 MTKYQIFRIRMWW
52. 5998-6234 MLAYQLCQRYVEKIVLVSDEEIKSAVSTLYKAGLVVEPSGTAAFTAIINDKIPDIQDKNVVVILSGGNIGKDELNNFPD
53. 6212-6241 MSLTTSQTEN
54. 6560-6670 MTYFYLTKIFEKRIILQNTFVYPKKLLFFTNRLNYSI
55. 6968-7015 MTYFHFGVTFFVKLMY

Variant Information


Variant PositionrsIDReferenceAlternate
27675191 rs40837786 A T
27675335 rs40991078 A G

References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: