Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001629*

Transcript Name: lnc1_tprkb
Type: lincRNA
Genomic Location: chr4:27674697-27681873
Nearest Gene: tprkb (NM_001007373)


lnc1_tprkb
Exons
2767469727681873











*A ribosome profiling study carried out by Pauli et. al. (2013) suggests this proposed lncRNA could have coding potential.

Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 1.16 0.64 0.39 0.95 0.88 1.83 1.76 1.51 1.11 1.45 -3.63 -3.7 0.22 -3.68 -3.67



Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 22-51 MKGFDLEKQL
2. 440-571 MLFKTTNTSLYIYLFSNRIKPVQSEKNGRCFSRHDYCRDAQRGL
3. 623-727 MEPNHTATPHLLQYSHQTGEHAAHRFVCVLFDLFS
4. 519-761 MGDVSADMITVEMLREACETVRCSPMDVIKTPMIPWSQTTLPLHTSCNIHIKLENMQRTGLFVSCLTCFLKQTGSFNKIQG
5. 773-808 MLTFFIYSADHF
6. 935-976 MENDKLLMCRSIWL
7. 970-999 MAVKFTVILE
8. 1211-1258 MHSEVINLNCLTLGDW
9. 1263-1295 MKKSVSLKFLS
10. 1417-1470 MGKLFHTHASIMDPKAKW
11. 1401-1568 MSAGNYGKAFSYACKHYGSKGKVVMPETAPISRSVLIQVRQSFIYTLQLHLPGFLC
12. 1439-1579 MQALWIQRQSGDARNCSHLQICAYTSTPIIYIHFAVALTRFPLLILQ
13. 1586-1654 MCQMFRIWELRLKESQLLSSWVL
14. 1703-1735 MILTSSLDIPG
15. 1645-1788 MGVVNRCVQEDGMTFLHSIDDPDLIAGHSRLRSCVVSKNCLLVKMISN
16. 1843-1929 MTFDHQNNDKNKNIIIEEKVYSFESFSSK
17. 2043-2075 MSIYFDNNAVN
18. 2211-2252 MEGSPKTENSLIVW
19. 2321-2434 MLEKKKQTLTLIVYFVPTIDVNGFCFPAFFRISFFVCV
20. 2379-2465 MSMASVFQHSSEYLFLCVFKNNYLTVSKC
21. 2556-2594 MFFFFFTLTVLVL
22. 2531-2671 MHLITHHSNVFFFFYSDCAGAVVLKLFSKMYITVHFETAFDPFFAIY
23. 2730-2915 MSYPIQMWWLFAVVVEGYFLVWPLPSNCLVVKTQRSMELNQKEVNHQNLFLYFVCLPEIVDV
24. 2911-2943 MCENLPVNLNE
25. 2943-2990 MNQVQFLVKEIKPDVS
26. 2983-3036 MFHKPLHNWKDNLCQTGY
27. 2939-3052 MNESSAVPCEGDQARCFISLYITGKTTFAKLATSCLKP
28. 3133-3189 MCFSALLRPRVMSFLTAKV
29. 3253-3312 MHLCRLECKTFFAKCQKSAE
30. 3527-3589 MLHILKRRKAINCCMNAVMFK
31. 3608-3688 MHEGHVTIRNNAATHFSEDVFCVLAVS
32. 3639-3701 MQQLTSQRTCSVFSRSPEFVL
33. 3860-3907 MLFQLYITVCGGFLSP
34. 3772-3957 MGISKKQSKKRTEFPNKTTRSGFLKILLEDVVPTVHYCMWWFPVPLMIGTRTGSNVCGSSIL
35. 3935-4063 MSAGPAFCSSAFRQLMTSLKDVSVVQPRLQPFQKQDSKYSGRS
36. 4165-4266 MAMLLLADISNLMFIVTVGAIYGLQFSFAPLEGV
37. 4334-4363 MDVRIGLYLF
38. 4394-4531 MDNKWIGISNFISKRYGHFTLLLTRLSNKRVRTNDQNICTYSDIGG
39. 4405-4554 MDWNIQLYFQKVWTFHFIIDPFKQQTCQNQRPKYMHLQRHWRVNCLPWCP
40. 4554-4616 MIKDLESDMMTALSWLLWRWD
41. 4740-4850 MPPDRTSVAHRFPGAVGSIHLHRFRSVAETHAGLHRF
42. 4870-4968 MLVRRDSTDKVVHINHLGGICFRACLSLLLICY
43. 4929-4982 MLSCMSQLAPYLLLAPCS
44. 5149-5256 MLFPVQGQGRCGAGLTCCATVAQLDVGFRTRTAPLW
45. 5178-5327 MWSRSYLLCHCGPTGRGFPNSHCPSLVNSSSSGTVHPHPEFWNLHVWSID
46. 4976-5338 MQLMHSHAVQLILEHFGEAQVNLSASSETVHFQLFYCLTKTPSAWMSWISCDPGACTICFFLFKVREDVEQVLLVVPLWPNWTWVSELALPLFGEFLILRDGASSPRILEPPCVVHRLIDR
47. 5366-5539 MPSWDLSVVLAGLQKILFEPLDSILRNFVIFCCFNVLIFLLGLTLFSFGYFCSMCTWQ
48. 5747-5791 MSCNVTFAPLTYTIS
49. 5823-5921 MYKSFIEKRPVGMDAKSIASGLAPPFAGMKSTL
50. 5982-6047 MIYFQECLRISFVRGMWRRLCW
51. 6144-6182 MTKYQIFRIRMWW
52. 5999-6235 MLAYQLCQRYVEKIVLVSDEEIKSAVSTLYKAGLVVEPSGTAAFTAIINDKIPDIQDKNVVVILSGGNIGKDELNNFPD
53. 6213-6242 MSLTTSQTEN
54. 6561-6671 MTYFYLTKIFEKRIILQNTFVYPKKLLFFTNRLNYSI
55. 6969-7016 MTYFHFGVTFFVKLMY
56. 21-50 MKGFDLEKQL
57. 439-570 MLFKTTNTSLYIYLFSNRIKPVQSEKNGRCFSRHDYCRDAQRGL
58. 622-726 MEPNHTATPHLLQYSHQTGEHAAHRFVCVLFDLFS
59. 518-760 MGDVSADMITVEMLREACETVRCSPMDVIKTPMIPWSQTTLPLHTSCNIHIKLENMQRTGLFVSCLTCFLKQTGSFNKIQG
60. 772-807 MLTFFIYSADHF
61. 934-975 MENDKLLMCRSIWL
62. 969-998 MAVKFTVILE
63. 1210-1257 MHSEVINLNCLTLGDW
64. 1262-1294 MKKSVSLKFLS
65. 1416-1469 MGKLFHTHASIMDPKAKW
66. 1400-1567 MSAGNYGKAFSYACKHYGSKGKVVMPETAPISRSVLIQVRQSFIYTLQLHLPGFLC
67. 1438-1578 MQALWIQRQSGDARNCSHLQICAYTSTPIIYIHFAVALTRFPLLILQ
68. 1585-1653 MCQMFRIWELRLKESQLLSSWVL
69. 1702-1734 MILTSSLDIPG
70. 1644-1787 MGVVNRCVQEDGMTFLHSIDDPDLIAGHSRLRSCVVSKNCLLVKMISN
71. 1842-1928 MTFDHQNNDKNKNIIIEEKVYSFESFSSK
72. 2042-2074 MSIYFDNNAVN
73. 2210-2251 MEGSPKTENSLIVW
74. 2320-2433 MLEKKKQTLTLIVYFVPTIDVNGFCFPAFFRISFFVCV
75. 2378-2464 MSMASVFQHSSEYLFLCVFKNNYLTVSKC
76. 2555-2593 MFFFFFTLTVLVL
77. 2530-2670 MHLITHHSNVFFFFYSDCAGAVVLKLFSKMYITVHFETAFDPFFAIY
78. 2729-2914 MSYPIQMWWLFAVVVEGYFLVWPLPSNCLVVKTQRSMELNQKEVNHQNLFLYFVCLPEIVDV
79. 2910-2942 MCENLPVNLNE
80. 2942-2989 MNQVQFLVKEIKPDVS
81. 2982-3035 MFHKPLHNWKDNLCQTGY
82. 2938-3051 MNESSAVPCEGDQARCFISLYITGKTTFAKLATSCLKP
83. 3132-3188 MCFSALLRPRVMSFLTAKV
84. 3252-3311 MHLCRLECKTFFAKCQKSAE
85. 3526-3588 MLHILKRRKAINCCMNAVMFK
86. 3607-3687 MHEGHVTIRNNAATHFSEDVFCVLAVS
87. 3638-3700 MQQLTSQRTCSVFSRSPEFVL
88. 3859-3906 MLFQLYITVCGGFLSP
89. 3771-3956 MGISKKQSKKRTEFPNKTTRSGFLKILLEDVVPTVHYCMWWFPVPLMIGTRTGSNVCGSSIL
90. 3934-4062 MSAGPAFCSSAFRQLMTSLKDVSVVQPRLQPFQKQDSKYSGRS
91. 4164-4265 MAMLLLADISNLMFIVTVGAIYGLQFSFAPLEGV
92. 4333-4362 MDVRIGLYLF
93. 4393-4530 MDNKWIGISNFISKRYGHFTLLLTRLSNKRVRTNDQNICTYSDIGG
94. 4404-4553 MDWNIQLYFQKVWTFHFIIDPFKQQTCQNQRPKYMHLQRHWRVNCLPWCP
95. 4553-4615 MIKDLESDMMTALSWLLWRWD
96. 4739-4849 MPPDRTSVAHRFPGAVGSIHLHRFRSVAETHAGLHRF
97. 4869-4967 MLVRRDSTDKVVHINHLGGICFRACLSLLLICY
98. 4928-4981 MLSCMSQLAPYLLLAPCS
99. 5148-5255 MLFPVQGQGRCGAGLTCCATVAQLDVGFRTRTAPLW
100. 5177-5326 MWSRSYLLCHCGPTGRGFPNSHCPSLVNSSSSGTVHPHPEFWNLHVWSID
101. 4975-5337 MQLMHSHAVQLILEHFGEAQVNLSASSETVHFQLFYCLTKTPSAWMSWISCDPGACTICFFLFKVREDVEQVLLVVPLWPNWTWVSELALPLFGEFLILRDGASSPRILEPPCVVHRLIDR
102. 5365-5538 MPSWDLSVVLAGLQKILFEPLDSILRNFVIFCCFNVLIFLLGLTLFSFGYFCSMCTWQ
103. 5746-5790 MSCNVTFAPLTYTIS
104. 5822-5920 MYKSFIEKRPVGMDAKSIASGLAPPFAGMKSTL
105. 5981-6046 MIYFQECLRISFVRGMWRRLCW
106. 6143-6181 MTKYQIFRIRMWW
107. 5998-6234 MLAYQLCQRYVEKIVLVSDEEIKSAVSTLYKAGLVVEPSGTAAFTAIINDKIPDIQDKNVVVILSGGNIGKDELNNFPD
108. 6212-6241 MSLTTSQTEN
109. 6560-6670 MTYFYLTKIFEKRIILQNTFVYPKKLLFFTNRLNYSI
110. 6968-7015 MTYFHFGVTFFVKLMY

Variant Information


Variant PositionrsIDReferenceAlternate
27675191 rs40837786 A T
27675335 rs40991078 A G

References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: