Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001623

Transcript Name: guca1apa2
Type: Promoter
Genomic Location: chr4:21275033-21278525
Nearest Gene: guca1a (NM_131870)


guca1apa2
Exons
2127503321278525



Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 0.79 0.75 0.59 1.44 1.09 1.1 1.45 1.47 1.52 0.59 1.26 1.28 1.71 1.05 0



Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 63-104 MMSNSTWIQSLTFI
2. 80-130 MDSKFNFHLVSINSNLK
3. 175-213 MVISIYFYYSFIF
4. 244-306 MQNFVLECCSLKFWIITMSLL
5. 264-320 MLQSEVLDHYNELIVSPEV
6. 329-370 MVKSATVSEPHLID
7. 543-581 MQSSCHEQSNHYF
8. 559-612 MNSQIIIFSSYLYFTSFI
9. 630-674 MWLYYICPAKNWAFE
10. 619-681 MWGICGCITYVLQKTGHLNNQ
11. 1239-1298 MMVSNFGNAPFQSGLLSSIF
12. 1417-1479 MKLSGIMKYVFKISINLYASR
13. 1442-1495 MCLKSVLIFMPQDNNTVF
14. 1594-1632 MNAHAVKTCCCLN
15. 1819-1911 MTDCVTVLHNLTEVLSMIPVVRATNNNLTSS
16. 2088-2171 MGVCERFAEWMANSTLVLPITLQTTGKG
17. 2015-2212 MDPRFSQKSVKFGKGKTMVKGYIQYGGVREICRVDGKFNTCAAHYITNHRKGIALLLILQPPHQSS
18. 2279-2443 MKEETLRMNPKNVDKLWESCKNAFFAIPDDFINKLFESSKLMGVIQNINYFSTAP
19. 2313-2477 MLTNFGSPARTLSLPFQMILLISYLSHPSLWELYKILIIFPLHHDFLFYTVHYFC
20. 2443-2481 MTFYSILYIISVK
21. 2549-2584 MIIFYFGKISHF
22. 2907-2957 MCITIKNNLSLLMYFLK
23. 3202-3264 MNVLCLKMTIKCQQTEFFSFI
24. 3409-3447 MFCMMHMMTAATY
25. 3405-3491 MNVLYDAYDDGCNLLTCDYQNKLGNALSV

Variant Information


Variant PositionrsIDReferenceAlternate

No variation reported in dbSNP within this genomic loci


References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: