Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001618

Transcript Name: lnc_impdh1b
Type: lincRNA
Genomic Location: chr4:18020667-18022176
Nearest Gene: impdh1b (NM_001014369)


lnc_impdh1b
Exons
1802066718022176




Expression Information

Negligible Expression across RNA-Seq datasets





Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 255-284 MARMCYLFCL
2. 223-396 MYYLLPVLMKAWHECVIYFVYREQSRTESCLESNRSTSSEPQFLFWLLCLVWLVQSEV
3. 427-456 MTTGPCGLFH
4. 309-497 MSGVEQVYFIGTAVSLLVALFGLASSVGGLMYPQGSCLADDNWTVWTVSLTEAADNAKRVGSK
5. 497-565 MNWSSDGINCTRRNNRCIKTTED
6. 513-626 MGSIALGEIIGVLRLLRINMKLFPPLHCELCFVESCEI
7. 646-708 MMASAVQIVVSFFFCCSGFWV
8. 760-885 MCECFVIDFTYFIAILTLYSWRNCTEKKSTHFFIWLQRELMD
9. 861-899 MVTKRTNGLKLVV
10. 910-951 MDVKMAYNYHKCIS
11. 942-986 MHLIRRYDLKNIYLN
12. 1086-1145 MTLSYDLYILISDYLYIVFG
13. 1204-1386 MELVNFTNNSEVKRKVKSKMFEVHFPKVFFFQNLLQYFVYILNIIYTVTVPLENKCLLLFF
14. 1368-1412 MFVIIFLTPFFVLFM
15. 1438-1467 MQDKYKTAVT

Variant Information


Variant PositionrsIDReferenceAlternate

No variation reported in dbSNP within this genomic loci


References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: