Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001614

Transcript Name: si:dkeyp-38g8.5pa2
Type: Promoter
Genomic Location: chr4:15380017-15381439
Nearest Gene: si:dkeyp-38g8.5 (NM_001123290)


si:dkeyp-38g8.5pa2
Exons
1538001715381439



Expression Information

Negligible Expression across RNA-Seq datasets





Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 20-70 MEHKWFSPLFQTPLSTA
2. 392-583 MVKIKEKDNSSSKSRRKKGTRPGLVIQETAAQPRPCRKSSCGRSEICTVCSHGTKKHHAVLNGH
3. 318-740 MCPEIITMKKSYQKDIKTAPDHKQKWSKSKKRTILQAKVDERRVRVRAWSSRRPQLSPGRVERAAAGDQRFVPSVAMAPRNTTQYLMDIEYAERLDVSIEECGVSRTPFNERHFSSSDSDYERSLDFQQRDFEELFFRNEI
4. 646-807 MKGISHRRTLITKDRWTSSSETSRSCSSGMKSEVFPLKPDLISSEREDRAAVNA
5. 926-1024 MWFHFVGSPCPTALRRLQLGETERSASQLRDDV
6. 1017-1127 MTCKPRPPARGQQVNPLHSLCTRCKSVCSHILSQCNL
7. 1160-1213 MHVCFERLLQVADLPRWI
8. 1140-1283 MHCSANGCMCVLRDFYRLPTFLDGSKRSVQPTQSLGTKPHGCLVTTAG
9. 1207-1299 MDLSGLCNPLRALGQSHMAAWSPLLGNCGNT
10. 1385-1414 MPKLVFTIKT

Variant Information


Variant PositionrsIDReferenceAlternate
15380927 rs41028377 C T

References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: