Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001613*

Transcript Name: si:dkeyp-38g8.5pa1
Type: Promoter
Genomic Location: chr4:15380017-15381372
Nearest Gene: si:dkeyp-38g8.5 (NM_001123290)


si:dkeyp-38g8.5pa1
Exons
1538001715381372







*A ribosome profiling study carried out by Pauli et. al. (2013) suggests this proposed lncRNA could have coding potential.

Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 2.6 2.02 3.6 3.52 3.16 2.81 2.88 2.83 2.36 2.4 3.05 3.04 3.41 3.62 3.65



Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 20-70 MEHKWFSPLFQTPLSTA
2. 392-583 MVKIKEKDNSSSKSRRKKGTRPGLVIQETAAQPRPCRKSSCGRSEICTVCSHGTKKHHAVLNGH
3. 318-740 MCPEIITMKKSYQKDIKTAPDHKQKWSKSKKRTILQAKVDERRVRVRAWSSRRPQLSPGRVERAAAGDQRFVPSVAMAPRNTTQYLMDIEYAERLDVSIEECGVSRTPFNERHFSSSDSDYERSLDFQQRDFEELFFRNEI
4. 646-807 MKGISHRRTLITKDRWTSSSETSRSCSSGMKSEVFPLKPDLISSEREDRAAVNA
5. 926-1024 MWFHFVGSPCPTALRRLQLGETERSASQLRDDV
6. 1017-1127 MTCKPRPPARGQQVNPLHSLCTRCKSVCSHILSQCNL
7. 1160-1213 MHVCFERLLQVADLPRWI
8. 1140-1283 MHCSANGCMCVLRDFYRLPTFLDGSKRSVQPTQSLGTKPHGCLVTTAG
9. 1207-1299 MDLSGLCNPLRALGQSHMAAWSPLLGNCGNT
10. 1385-1414 MPKLVFTIKT

Variant Information


Variant PositionrsIDReferenceAlternate
15380927 rs41028377 C T

References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: