Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001612

Transcript Name: mestpa2
Type: Promoter
Genomic Location: chr4:15066629-15069816
Nearest Gene: mest (NM_131043)


mestpa2
Exons
1506662915069816




Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 0.16 -2.07 -2.08 -2.24 -2.08 -2.6 -2.37 -2.62 -2.33 -2.09 0 0 -2.08 -2.04 -2.05



Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 9-53 MANGAWGTVTLGVFG
2. 76-162 MCKLSLFDSCKSKQSSCLVCYKWDTLKTR
3. 132-185 MLQVGHVENQVSTKCFFV
4. 173-265 MLLCLVKVSQLIAFAKCQTCVQGFEGVCERK
5. 317-352 MVSKSVLKQLCK
6. 466-513 MQNDFGSFITKTLYLK
7. 554-583 MQIKLDPLIW
8. 837-881 MLIKYGTKNMPISSL
9. 850-903 MELKICQYLVYELIATKV
10. 989-1084 MACNIQFFNIQLLIIQIQIVLGYFKLHNQIKS
11. 1149-1181 MDALAFWDGVF
12. 1193-1255 MGLWMSYIYFFTVYGTHVYTP
13. 1233-1286 MVHMYTPLDYPTQCHGNL
14. 1171-1296 MGSFKHNYGSLDVIHLFFYRLWYTCIHPLIILHNVTAICNFF
15. 1271-1336 MSRQFVTFFDKVANSYDLIHTI
16. 1317-1373 MISFIQFSTVCFSPNIAWV
17. 1535-1627 MTNYLFIIIIIYFSTVFLLCFCGFFYNSIST
18. 1692-1733 MSYRTYNINSRLFT
19. 1818-1892 MNSLKYIFSKKKNEFLSCIYTKNLI
20. 1855-1947 MNSYHVFTLKILFNLCIHLFVCSCHKNNLGC
21. 1952-1996 MAINKKYITLHYYAI
22. 2090-2125 MLKEKKTFLNYC
23. 2262-2387 MHKICNRFLLFDLFCKCNNSLLGYDCNHILLVSEYYLSFFNK
24. 2510-2539 MPLCLAEMES
25. 2332-2700 MTVITYYLFQNIIYHFLTSDEIEIKPIQYKQNYQTPCDLFPKYNSIILYICPAFTFKQKYAFVLGRNGELIFSLAIIELDCNKKKKKKKNFQLILRLYYINPTCFLFITALFNLFFSSSSRFD
26. 2821-2865 MCQCCAHLWRICASA
27. 2829-2900 MLCPLVEDLCICMKTARGQEMKSV
28. 3143-3187 MLTFLIKNKKFMCDS

Variant Information


Variant PositionrsIDReferenceAlternate

No variation reported in dbSNP within the exonic region of the transcript



References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: