Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001606

Transcript Name: lnc1_pus7l
Type: lincRNA
Genomic Location: chr4:13222756-13227106
Nearest Gene: pus7l (NM_001044957)


lnc1_pus7l
Exons
1322275613227106





Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 0.64 0.7 0.11 0.26 -0.34 0.42 -0.07 -0.89 -1.09 1.64 0 0 0 0 0



Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 56-88 MTSSYRLSLNI
2. 121-156 MCLVINIFVLSK
3. 164-277 MNKQTFYHSLYLQGPSCGHQVYQSVFNQKWLSALLCCR
4. 350-385 MNVETIGEILVQ
5. 388-423 MSSQRNWSNGGR
6. 413-508 MEVAKWPVFRVIWTNTDKQHETQDLQHYFWVV
7. 598-627 MLFLTPDQTT
8. 627-674 MTARNEGKYISFIAFY
9. 640-804 MKVNTFLSLLSIDSKQREREREREREREREVLNTVLSPACGVLSTSVCLQSSFSR
10. 756-860 MWSFEHFCLFAKQLFKMNIIHTHHYFSKFCLTDDI
11. 881-925 MLLLIKFILLFNYCQ
12. 943-984 MLRLELKCLCCAFV
13. 963-1067 MSMLCVCLKGHQCMYQCKCSLYARNVSATMVKQVS
14. 1027-1080 MQGMCQPPWSNRLVKVKS
15. 1083-1136 MDELNDHKRELKLTCRRC
16. 1133-1207 MLVEDKLDRREGTGDFSWFIAGLNI
17. 1207-1260 MIFMTKKLNKFTIRIRSH
18. 1266-1367 MMVIHFHVIQVMLDFHIIGRNHTMTNHSLFSSQS
19. 1385-1417 MSVFLYESLKC
20. 1414-1449 MLIVSVHGQEHC
21. 1433-1534 MDKNTVNWRKKMKQKRENCVRESQSQFPLRINVM
22. 1586-1645 MCALNSSFLSAPHFIFSLFV
23. 1572-1649 MLRLLCVLLTLHFYQPLILFSPYLYE
24. 1645-1734 MNKFFSLLKMFRIKATAAGLFTVYLLLSAT
25. 2039-2098 MSSMPASCASKQTFYVVILL
26. 2122-2193 MYSMRLCKRLQDILQCLEGYFIQK
27. 2139-2264 MQALTGHFTMLRGILYPKMNILMLKLIRHQHLNIKLRLMRKC
28. 2261-2326 MLNENLLHLLTLKSSLQVSLFC
29. 2268-2438 MKIYFIYSPSNPLYKFLYSVEHKRKYFEESWKSVTIDFPNRENKYYEDNDSRYSAFF
30. 2404-2460 MKTTIPGIQLSSKYILINK
31. 2475-2507 MMTDSSVLAVV
32. 2548-2667 MKLLLQYTCQCVEISHLCLCCSTCRLPSFAFWRVTPLERE
33. 2577-2849 MCGDFSLVFVLFNMSLTIICFLEGHSSRKGIMRTKTTVEEAAERLFNALFFLQAKAKPLLDPVLDLRERHHHPVLKHTTAFTQCGDVQPVL
34. 2716-2910 MHFFFCRQKQNPFWTQFWISGRDTTIPFSNTPQHSLSVEMCSLCYEARLVAGQFSFSLGCTNSGF
35. 2919-2966 MKELSSARLLHDANKE
36. 2989-3057 MLPKTRPAQYIDSASISQCANLQ
37. 3042-3083 MCKSAIVTSQDLLC
38. 3219-3257 MIKCVALTKNNCI
39. 3291-3329 MFEVYHKSVSKCS
40. 3323-3412 MFLGQDGMLLNSVRITLMKGFQSYKVIFYI
41. 3511-3606 MLVVCLLYFMQIHSSTKSNNQTYSKFKLLVVL
42. 3522-3611 MFIIFYANSLLDKIKQSNLFQIQVVSRIVK
43. 3658-3714 MSVFPNILQPYLKPRTCAN
44. 3849-3908 MWQENIDQCIKTSGLSYTAS
45. 3908-3952 MKMASKIYDQTYKYQ
46. 3930-3986 MIKLTNINNSTVEINCCCF
47. 4010-4075 MQRISLELLVMLKVLISCCCCF
48. 4132-4221 MKSQRARYLYTLLQDSGLIFREPDADSSFI
49. 4202-4312 MLIHHLFELFLLLYLLICIFLYCFCKLLLMWKDRLSL

Variant Information


Variant PositionrsIDReferenceAlternate

No variation reported in dbSNP within the exonic region of the transcript



References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: