Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001605

Transcript Name: edal107
Type: lincRNA
Genomic Location: chr4:13176877-13180734
Nearest Gene: pus7l (NM_001044957)


edal107
Exons
1317687713180734





Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 1.49 1.5 0.99 0.39 -0.23 0.35 0.53 -0.35 0.5 0 0 0 -0.1 -0.25 0.82



Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 56-88 MTSNYRLSLNI
2. 163-276 MNKQTFYHSLYLQGPSCGHQVYQSVFNQKWLSALLCCR
3. 349-384 MNVETIGEILVQ
4. 387-422 MSSQRNWSNGGR
5. 412-516 MEVANGQCLESSGQTQTNNTRHKIFSTTFGWFVYC
6. 627-665 MKVNKYIYLIAYD
7. 875-970 MWCSEHFCLFTKQLFKNIIHTHHFSKFCLTDI
8. 991-1026 MLSLINLVYFII
9. 1081-1182 MSMLCVCFKGHQCMYQCKCSLYARNVSAMAKQVS
10. 1061-1195 MLRLELKCLCCAFVLKATNVCISASVACMQGMCQPWLNRLVEVKS
11. 1198-1251 MDKLNDHKREPKLTCCRC
12. 1211-1261 MTTRGNRSSPAVDVSGR
13. 1248-1298 MLVEDKLDGKEGTVDFN
14. 1363-1458 MIFSAGVIDNIDKLFFSQIYNIYHTKKLIKNK
15. 1495-1524 MQACSQGVFK
16. 1613-1645 MQTIILTLTLH
17. 1677-1739 MTEVKSSFTIIIFYADAQEKT
18. 1854-1895 MSIFPISCSPSFYC
19. 1717-1968 MQMHRKRLDHRSQSKLEKSFQIELFKSSGETISLSQYISQQNKISPCQFFQYHAALVSTVDRNSHLITSAVCIMSFVIETIRLC
20. 1965-2021 MLKIINHNYNNYQSKKCDL
21. 2021-2071 MKASCASKQTFYVVILL
22. 2170-2244 MFTLLTFPQVVPNTKESILRKAGNL
23. 2112-2279 MKALTGHFTMLREIVYPKTNVYSTYFPSGCSKHKRKYFEESWKSVTIDFNRGKQIL
24. 2279-2335 MKTTIPGFQLSSKYLLINK
25. 2350-2391 MMTDSSVLAVVWVI
26. 2423-2542 MKLLLQYTCQCVEISHLCLCCSTCRLPSFAFWRVTPLERE
27. 2452-2601 MCGDFSLVFVLFNMSLTIICFLEGHSSRKGIMRTKTTGEKAGEAIFLCLL
28. 2702-2779 MCSLCYEARLVAGWFSFSLGCTNSGF
29. 2788-2835 MKELSSARLLHDANKE
30. 2858-2926 MLPKTRPAQYIDSASISQCANLQ
31. 2911-2952 MCKSAIVTSQDLLC
32. 3088-3126 MIKCVALTKNNCI
33. 3160-3198 MFEVYHKSVSKCS
34. 3192-3281 MFLGQDGMLLNSVKITLMKGFQSYKVIFYI
35. 3391-3465 MFIIFYADSLLDKIIAIKLIPNSSC
36. 3528-3584 MSVFPNILQPYLKPRTCAN
37. 3380-3589 MLVVCLLYFMQIHSSTKSSQSNLFQIQVVSRIVKLYSYCSLYRRKTKYCDVSFSQYPAALPKTQNLCKLI
38. 3719-3778 MWQENIDQCIKTSGLSYTAS
39. 3778-3822 MKMASKIYDQTYKYQ
40. 3800-3856 MIKLTNINNSTVEINCCCF

Variant Information


Variant PositionrsIDReferenceAlternate

No variation reported in dbSNP within this genomic loci


References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: