Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001603*

Transcript Name: lnc_ccdc87
Type: lincRNA
Genomic Location: chr4:12690505-12691357
Nearest Gene: ccdc87 (NM_001044817)


lnc_ccdc87
Exons
1269050512691357





*A ribosome profiling study carried out by Pauli et. al. (2013) suggests this proposed lncRNA could have coding potential.

Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 0 0.81 0 0.39 1.57 1.05 1.04 1.19 1.12 2.41 0 0 1.11 1.5 0



Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 69-197 MPLVKSKTSTGSHVKTSQSKSESNRSDNTWPRGRSSTPAGSTV
2. 11-478 METDVNMTEALTAMESDNANAACQIKNIDWISCKDFTIEIGEQQIRQYMATWEIQHPGWLYSLTFLQQAELEFKTQYQYEVQWSIPTRFTPIPRATTRVYFIIEISKIKPDSLPVNVHFIIESNRSKHVPGQMRFREKWLMDVIESKTLLLDTVDF
3. 501-542 MTVLAENICQWKSI
4. 530-583 MEINLVVPNRNITSFSFH
5. 651-686 MSIFIDTYLISL
6. 713-760 MFVIFKRLLVGPLVLL
7. 774-830 MAQIISSARLNVNLKYGVE

Variant Information


Variant PositionrsIDReferenceAlternate

No variation reported in dbSNP within this genomic loci


References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: