Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001601

Transcript Name: lnc_zgc:63566
Type: lincRNA
Genomic Location: chr4:11299320-11303683
Nearest Gene: zgc:63566 (NM_201169)


lnc_zgc:63566
Exons
1129932011303683



Expression Information

Negligible Expression across RNA-Seq datasets





Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 98-151 MDQIKTALGEIKQALLLN
2. 310-342 MLTSLLKASIR
3. 237-362 MQKDHTLTALSLSGRRHLCHLMGTHADFPSESIYTLTKETRI
4. 438-512 MYIHDLQMTTHKLHTIPKPTCDCFF
5. 587-706 MGDLPKKKKKNTLFLFISLCFSMMVSSPCNCWMLTYLKSP
6. 717-779 MFVSLEAIYMMVDLTLTQSGF
7. 791-868 MVYKKTPRDLECCGIGIFTALQTFLK
8. 888-1058 MTITKRSTFQFYGNIKNIPTTGIPLISMASLTILLLLKRKYCSLLTKHWHLLAWRLI
9. 1444-1482 MLPSTLQISRTPP
10. 1350-1535 MRRSAILLRNFPSPVVCNVMGSTNVLIPQAFDVAIHSADLSHTPIMNGSPNNDFSFNKLDFV
11. 1535-1585 MKIVGSCRFQWGVLMMI
12. 1769-1834 MCNQNLARNFSNVFFFSLGITE
13. 1489-1848 MDPQTMTFPSTNLTLYENRGFMQVPMGSINDDLDAVLQMIHLNKNLPFYTFPNDQLELLLFVALKTGINDKTFVRWCIITRMSKNSVLLLELLNVQPKFGEKLFKCLFFLFGHHRIKKIR
14. 1803-1940 MSFFSLWASQNKENKMKIRCIRVKDKNWFSNTTIKKVKSSDMSPTH
15. 2217-2261 MAMKHYVECIFMYYK
16. 2233-2271 MSNVFLCIISNVF
17. 2281-2409 MLTKAICNIKSGHFHCKKIPFLLSYLLFRLISITLKHLLYLVV
18. 2524-2580 MSKIICQRGKQNKLDPKQK
19. 2658-2723 MMYSLRYMHEKKHKSGSLRLIV
20. 2733-2927 MLTKAIHNTKVDNILCVSMKITNLDTKKRASHLFMLVEERCSILPTDRQHSNRALEAANHHKELN
21. 3045-3092 MRDTSCQARFHKAVTN
22. 3126-3161 MGVFGHQIFTPL
23. 3164-3223 MKRVHGEHSEELSAIFMCDL
24. 3177-3239 MESIQRSFLPYLCAICEPAFK
25. 3257-3427 MLTMQLAMKLHKHPASHTHTHTHTHTHTHTHKIFTLPRSTARRQIDQTQKKPSIKCA
26. 3570-3749 MGSAAGCRLSNKTNTRTALPENYISFLLPFLSRSIEGCSITEDEDIKEHRRADVHFTRQE
27. 3697-3786 MKTSKSTEGQMFTSHAKNKHFQLWFNWHPS
28. 3951-4082 MNGCRIVGFLIIFMQMCLHHSQQFVWFYLVEWGGMGGKHDYFCL
29. 3955-4089 MGAGLWVFLLYSCKCVCITANSLFGFIWLNGEGWGGNMIIFVFKM
30. 4263-4343 MLEKKKKSEKINPGKMLKLWNVISLQE

Variant Information


Variant PositionrsIDReferenceAlternate

No variation reported in dbSNP within this genomic loci


References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: