Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001593

Transcript Name: lnc1_si:dkey-207j16.2
Type: lincRNA
Genomic Location: chr4:9831773-9834388
Nearest Gene: si:dkey-207j16.2 (NM_001045067)


lnc1_si:dkey-207j16.2
Exons
98317739834388




Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 1.24 0.74 0.7 0.7 0.89 1.09 1.48 0.96 1.42 1.09 1.55 1.41 1.44 1.16 2



Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 291-353 MRGCLTLSLYILNSNYQFICS
2. 357-446 MSDSNREQHVNKAVQQTGELCLNISLKTLQ
3. 459-497 MNLTATEVQRIKT
4. 508-540 MQEKYCTVTYR
5. 540-611 MSRFSLHSCPLSQRVSVILVVGLH
6. 500-622 MRKCRRNTVQLLTDESLFTAFLSFISACVGYFSCRTALNVV
7. 785-844 MENCTRVANRTSYSVKASFI
8. 615-851 MLFSDIKTLSLSCHLQFMCLKLHTRAAAAPKQTSHCQHPEALGQTEREVARAAWWSGWRTALESLTGRVTALKPRLFKV
9. 876-959 MHNLKCRHPETIMHLLGRLLNSSMSSAK
10. 969-1019 MWSSAPSCGHESVLFRS
11. 997-1044 MNQCCSDHELVVFSRR
12. 1019-1117 MSSWCSVAGKRAEKSMNKTHLKAILLFMAGLDV
13. 1207-1242 MCKQSKLRRLLW
14. 1268-1306 MFCLVISNDIYNH
15. 1323-1403 MISCCHVYVTDIKSIVATDFRFRHKMH
16. 1482-1532 MIFWIVYFLLLNIKQNN
17. 1587-1631 MVYKIHFSPSEVDKI
18. 1571-1645 MAIMNYGLQNSFFPLRSRQDLERQK
19. 1645-1692 MSCFKPKLNKKISLNL
20. 1727-1759 MCLCYSLNELK
21. 1763-1990 MQYLLNNLLFFFLLDDFCWNGSTLMSVLDSSPGDQQSSTFYMFLLSNTHRFLKTGCESGSVFTKLIFSSTSEKVLS
22. 2096-2140 MMSACLLIMHTVIGR
23. 2202-2243 MWLYSNKGFKMPGK
24. 2092-2271 MDDVSMLVNYAHSDWTISRGGVSVRNVLIETLQRTISCGCIQIKVLKCRVSEELNSLLLI
25. 2360-2395 MYFLFTYTLNNI

Variant Information


Variant PositionrsIDReferenceAlternate
9832271 rs179372198 A G
9832338 rs179372336 T A

References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: