Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001592

Transcript Name: lnc6_tmem243b
Type: lincRNA
Genomic Location: chr4:8693214-8696549
Nearest Gene: tmem243b (NM_212919)


lnc6_tmem243b
Exons
86932148696549





Expression Information

Negligible Expression across RNA-Seq datasets





Mutant Information


ChromosomeMutant PositionZFIN ID
chr4 8693659 la024765



Predicted Open Reading Frames


ORFRangeSequence
1. 58-87 MIFQDILQHI
2. 191-220 MDNPPRLWVK
3. 187-237 MNGQSSETLGKVDARLT
4. 250-417 MHVRRCCSQLKCFAVSCLQNQTAFISILLESANNSRAAGFCAFTIQLPPHQSLIEI
5. 422-481 MAMHENDTYDIQDHVKISHI
6. 432-518 MKMTHMTFKIMLKFHIYKISHLKHVCLQI
7. 585-692 MFKYILYNLRCSYMDISALLSLKGDFQRLKPEQFAL
8. 888-950 MSLSLHTCSFSSVVQAAACAL
9. 908-961 MFIQFSCTGCSVCFINQC
10. 748-966 MLSTSQCERNIKLRLFKIYILLLKLVHHTFNSHYPFKQMFLSPKTVKCHCHFIHVHSVQLYRLQRVLYKSVLS
11. 1013-1075 MKISTQEFLLNASSSASVMKM
12. 1105-1134 MDESLAFTDL
13. 1137-1181 MTIHFQHRLNHSQTS
14. 1109-1219 MSLWLLQTCDDHSFPAQVKPQPNFMRTDHSSCIYGKS
15. 1346-1423 MSEHVQLRHFILTFDMKLIVVYVFAS
16. 1410-1505 MCLLHNSILPVHEWMSFITGTVYPHVPQLCFC
17. 1444-1551 MSGCPSLQGLSIHTSHSSAFVDRMTQTRPLFCRRDA
18. 1569-1676 MQYITVKAQLQHSIETPAAIIGFFAFVMFSYSLICE
19. 1763-1792 MKHQCFTFVY
20. 1870-1902 MDSKLHTTKYF
21. 1957-2013 MRLRITLSRAYGLLTMFCL
22. 2021-2074 MWCNRSKNKFSYELASGY
23. 2335-2403 MKNQMITVNKYCGVFEPYYSKLN
24. 2433-2462 MIIQQPDINE
25. 2761-2880 MLSGLCVSVLFAVVLKYLALTDFDNNIDFLIDLVIAGCVG
26. 2871-3008 MCRLNGFGVVVATGDRHEAETHTPPSGPDGELRLLAILHYFVLWAK
27. 2920-3114 MKLRRIRRLVDLMENCVCWQYSITLCSGQNNLTRHKCENWRFIFINWHLIKLISDLFIQEQNHVE
28. 3107-3145 MLSERIKTGQNIF
29. 3159-3233 MCLRVKFVSLLSLMMLITWLTNLSC
30. 3302-3334 MFRQIKSVLYN

Variant Information


Variant PositionrsIDReferenceAlternate

No variation reported in dbSNP within this genomic loci


References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: