Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001591

Transcript Name: lnc5_tmem243b
Type: lincRNA
Genomic Location: chr4:8693187-8696939
Nearest Gene: tmem243b (NM_212919)


lnc5_tmem243b
Exons
86931878696939






Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 1.49 1.2 0.58 -0.2 0.17 0.05 0.02 0.9 0.64 2.03 -1.79 0 -1.68 -1.66 -3.98



Mutant Information


ChromosomeMutant PositionZFIN ID
chr4 8693659 la024765



Predicted Open Reading Frames


ORFRangeSequence
1. 85-114 MIFQDILQHI
2. 218-247 MDNPPRLWVK
3. 214-264 MNGQSSETLGKVDARLT
4. 277-444 MHVRRCCSQLKCFAVSCLQNQTAFISILLESANNSRAAGFCAFTIQLPPHQSLIEI
5. 449-508 MAMHENDTYDIQDHVKISHI
6. 459-545 MKMTHMTFKIMLKFHIYKISHLKHVCLQI
7. 612-719 MFKYILYNLRCSYMDISALLSLKGDFQRLKPEQFAL
8. 915-977 MSLSLHTCSFSSVVQAAACAL
9. 935-988 MFIQFSCTGCSVCFINQC
10. 775-993 MLSTSQCERNIKLRLFKIYILLLKLVHHTFNSHYPFKQMFLSPKTVKCHCHFIHVHSVQLYRLQRVLYKSVLS
11. 1040-1102 MKISTQEFLLNASSSASVMKM
12. 1132-1161 MDESLAFTDL
13. 1164-1208 MTIHFQHRLNHSQTS
14. 1136-1246 MSLWLLQTCDDHSFPAQVKPQPNFMRTDHSSCIYGKS
15. 1373-1450 MSEHVQLRHFILTFDMKLIVVYVFAS
16. 1437-1532 MCLLHNSILPVHEWMSFITGTVYPHVPQLCFC
17. 1471-1578 MSGCPSLQGLSIHTSHSSAFVDRMTQTRPLFCRRDA
18. 1596-1703 MQYITVKAQLQHSIETPAAIIGFFAFVMFSYSLICE
19. 1790-1819 MKHQCFTFVY
20. 1897-1929 MDSKLHTTKYF
21. 1984-2040 MRLRITLSRAYGLLTMFCL
22. 2048-2101 MWCNRSKNKFSYELASGY
23. 2362-2430 MKNQMITVNKYCGVFEPYYSKLN
24. 2460-2489 MIIQQPDINE
25. 2788-2907 MLSGLCVSVLFAVVLKYLALTDFDNNIDFLIDLVIAGCVG
26. 2898-3035 MCRLNGFGVVVATGDRHEAETHTPPSGPDGELRLLAILHYFVLWAK
27. 2947-3141 MKLRRIRRLVDLMENCVCWQYSITLCSGQNNLTRHKCENWRFIFINWHLIKLISDLFIQEQNHVE
28. 3134-3172 MLSERIKTGQNIF
29. 3186-3260 MCLRVKFVSLLSLMMLITWLTNLSC
30. 3329-3367 MFRQIKSVLYNEY
31. 3360-3482 MNINHLFAFITSALFITERCIRVRSEFQLHLVDNKWICINT
32. 3626-3673 MCDKLCNSDDDNKRLI
33. 3685-3750 MMLLQIVYVFHCEFELIKGDLK

Variant Information


Variant PositionrsIDReferenceAlternate

No variation reported in dbSNP within the exonic region of the transcript



References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: