Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001589

Transcript Name: lnc3_tmem243b
Type: lincRNA
Genomic Location: chr4:8685717-8689203
Nearest Gene: tmem243b (NM_212919)


lnc3_tmem243b
Exons
86857178689203





Expression Information

Negligible Expression across RNA-Seq datasets





Mutant Information


ChromosomeMutant PositionZFIN ID
chr4 8685882 la029044
chr4 8686108 la024763



Predicted Open Reading Frames


ORFRangeSequence
1. 58-87 MIFQDILQQI
2. 191-220 MDNPPRLWVK
3. 187-237 MNGQSSETLGKVDARLT
4. 422-466 MAMHENDTYDIQDHV
5. 432-518 MKMTHMTFKIMFKFHIYKISHLKHVCLQI
6. 583-675 MFKYILYNLRCSYMDISALLSLKGDCQCVFS
7. 663-704 MCLQLRSLTQGIWW
8. 749-844 MLRSLYKIGGNTIQVKLTSTLQFQLKPEQFAL
9. 1042-1104 MSLLLHTCSFSSVVQAAACAL
10. 1062-1115 MFIQFSCTGCSVCFINQC
11. 902-1120 MLSTSQCERNIKLRLFKIYILLLKLVHHTFNSHYPFKQMFLSPKTVKCHCYFIHVHSVQLYRLQRVLYKSVLS
12. 1167-1229 MKISTQEFLLNASSSASVMKM
13. 1259-1288 MDESLASTDL
14. 1291-1335 MTIHFQHRLNHSQTS
15. 1263-1373 MSLWLLQTCDDHSFPAQVKPQSNFMRTDHSSCIYGKS
16. 1500-1577 MSEHVQLRHFILTFDMKLIVVYVFAS
17. 1564-1659 MCLLHNSILPVHEWMSFITGTVYPHVPQLCFC
18. 1598-1705 MSGCPSLQGLSIHTSHSSAFVDRMTQTRPLFCRRDA
19. 1908-1937 MKHQCFTFVY
20. 1983-2069 MRVKTAWLGHKGTVSYTPLNIFEFSSLTI
21. 2102-2158 MRLRITLPRAYSLLTMFCL
22. 2166-2198 MWCNRSKNKFS
23. 2480-2548 MKNQTFIVNKYCGVFEPYYIKLN
24. 2578-2607 MIIQQPDINE
25. 2906-3025 MLSGLCVSVLFAVVLKYLALTDFDNNIDFLIDLVIAGCVG
26. 3016-3153 MCRLNGFGVVVATGDRHEAETHTPPSGPDGELRLLAILHYFVLWAK
27. 3065-3259 MKLRRIRRLVDLMENCVCWQYSITLCSGQNNLTRHKCENWRFIFINWHLIKLISDLFIQEQNHVE
28. 3252-3290 MLSERIKTGQNIF
29. 3304-3378 MCLRVKFVSLLSLMMLITWLTNLSC
30. 3447-3485 MFRQIKSVLYNEY

Variant Information


Variant PositionrsIDReferenceAlternate
8689130 rs41018195 A T

References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: