Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001588

Transcript Name: lnc2_tmem243b
Type: lincRNA
Genomic Location: chr4:8685690-8689587
Nearest Gene: tmem243b (NM_212919)


lnc2_tmem243b
Exons
86856908689587






Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 1.89 1.52 0.79 0.55 -1.66 0.65 0.66 1.16 0.86 2.11 -3.9 -1.64 -1.66 -1.65 0



Mutant Information


ChromosomeMutant PositionZFIN ID
chr4 8685882 la029044
chr4 8686108 la024763



Predicted Open Reading Frames


ORFRangeSequence
1. 85-114 MIFQDILQQI
2. 218-247 MDNPPRLWVK
3. 214-264 MNGQSSETLGKVDARLT
4. 449-493 MAMHENDTYDIQDHV
5. 459-545 MKMTHMTFKIMFKFHIYKISHLKHVCLQI
6. 610-702 MFKYILYNLRCSYMDISALLSLKGDCQCVFS
7. 690-731 MCLQLRSLTQGIWW
8. 776-871 MLRSLYKIGGNTIQVKLTSTLQFQLKPEQFAL
9. 1069-1131 MSLLLHTCSFSSVVQAAACAL
10. 1089-1142 MFIQFSCTGCSVCFINQC
11. 929-1147 MLSTSQCERNIKLRLFKIYILLLKLVHHTFNSHYPFKQMFLSPKTVKCHCYFIHVHSVQLYRLQRVLYKSVLS
12. 1194-1256 MKISTQEFLLNASSSASVMKM
13. 1286-1315 MDESLASTDL
14. 1318-1362 MTIHFQHRLNHSQTS
15. 1290-1400 MSLWLLQTCDDHSFPAQVKPQSNFMRTDHSSCIYGKS
16. 1527-1604 MSEHVQLRHFILTFDMKLIVVYVFAS
17. 1591-1686 MCLLHNSILPVHEWMSFITGTVYPHVPQLCFC
18. 1625-1732 MSGCPSLQGLSIHTSHSSAFVDRMTQTRPLFCRRDA
19. 1935-1964 MKHQCFTFVY
20. 2010-2096 MRVKTAWLGHKGTVSYTPLNIFEFSSLTI
21. 2129-2185 MRLRITLPRAYSLLTMFCL
22. 2193-2225 MWCNRSKNKFS
23. 2507-2575 MKNQTFIVNKYCGVFEPYYIKLN
24. 2605-2634 MIIQQPDINE
25. 2933-3052 MLSGLCVSVLFAVVLKYLALTDFDNNIDFLIDLVIAGCVG
26. 3043-3180 MCRLNGFGVVVATGDRHEAETHTPPSGPDGELRLLAILHYFVLWAK
27. 3092-3286 MKLRRIRRLVDLMENCVCWQYSITLCSGQNNLTRHKCENWRFIFINWHLIKLISDLFIQEQNHVE
28. 3279-3317 MLSERIKTGQNIF
29. 3331-3405 MCLRVKFVSLLSLMMLITWLTNLSC
30. 3474-3512 MFRQIKSVLYNEY
31. 3505-3537 MNINHLFAFIT
32. 3771-3818 MCDKLCNSDDDNKRLI
33. 3830-3895 MMLLQIVYVFHCEFELIKSDLK

Variant Information


Variant PositionrsIDReferenceAlternate

No variation reported in dbSNP within the exonic region of the transcript



References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: