Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001585

Transcript Name: ledal6
Type: lincRNA
Genomic Location: chr4:6616245-6620138
Nearest Gene: tnnt2e (NM_001201540)


ledal6
Exons
66162456620138





Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 0.2 -0.76 -0.71 -0.36 -0.1 0.75 0.57 0.59 1.06 1.55 1.5 1.34 0.98 0.65 0



Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 13-45 MTDATTRADCF
2. 3-173 MGLDDRRNNTCRLFLIQFLQMTAIKITHNMQWMQRQCSCQAPPVSNFKLKENFCWVK
3. 173-202 MSNTGQFLTL
4. 303-335 MLPTLFTACFA
5. 357-425 MVLSIVGLKSRKYDFKTTLALFI
6. 438-470 MLYFVNHWLLI
7. 490-543 MKLSILLGGKSECVNALS
8. 525-713 MCECIKLKLVLYSHIPSGTTSDMLHVLFTIEVILVLYSDIQTFYLIIQFQKSILCIFQIGKSY
9. 723-752 MTIKVQHCSQ
10. 766-816 MLFESHNRMLIPTEYSW
11. 847-921 MCEYKTNFTSICSLKSHVNMTSKQH
12. 948-980 MLYFDDHWLLI
13. 1000-1029 MKLLILLINI
14. 1173-1211 MLYFNSHCLLIRF
15. 1234-1314 MIHLACKEAYICTKPSPRIQLFHLLSR
16. 1407-1490 MGCGWKGHPLRKNLLDRLAVHSAVATPD
17. 1542-1586 MNEYSINYKKKVNLT
18. 1632-1697 MLHILLTMVINTNKLTNVLIIK
19. 1750-1809 MILHLFMYYYVENITDDAYE
20. 1796-1891 MMHMNKYMILCGRKYSILYNNTSQLCHVTLLH
21. 1870-1920 MSCYFITLILYKYLLFF
22. 1924-1956 MLHIPKKIYLT
23. 2164-2217 MLVFFYCRCGNLTVDIII
24. 2357-2395 MFIYRYKQSGQYN
25. 2719-2769 MSCVTLEQLNAFQSLFN
26. 2747-2806 MHSKVYLTDCILMTLQHPCC
27. 2800-2868 MLLKESYKMEKTHNNRSPEVYQH
28. 2993-3031 MEGHFSICITVYC
29. 2905-3057 MIANYLQVKLLTCLCVLSFTKHFGYHHCLYGGSLLYLYNCLLLDLLCNMCQ
30. 3457-3555 MMIICCCTGDVDHVLSYPNYVGYHQLLCGGSLL
31. 3494-3778 MCCLTLITLVTISYFVEGHSSRKQMMVNETGEEGSKIFITYTFYFFPAVMKYNPCWTWLRKLQGETELVSPPLQAQLTHCALILQRSGWDRSSNH
32. 3664-3855 MAPEAPGGDRTGIPTSPGTTHSLCTHIAKIRLGSIQQPLKSWGSDLTTEPLISCLDACWNLCHC
33. 3830-3868 MPAGIYVTADLFQ
34. 3786-3893 MGQRSYHRATDLLSGCLLEFMSLLTCFNKTIYTSEL

Variant Information


Variant PositionrsIDReferenceAlternate
6619973 rs179371493 C T
6619979 rs179371502 G C

References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: