Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001582

Transcript Name: foxp2oa1
Type: Overlapping
Genomic Location: chr4:6028218-6029187
Nearest Gene: foxp2 (NM_001030082)


foxp2oa1
Exons
60282186029187



Expression Information

Negligible Expression across RNA-Seq datasets





Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 15-266 MQQDHLTRRHCCCASFLFSQPTNNMAPKNPNTHMILCFFLMMFVKTTEAFDGGDAAALLLGASVTIVGLCACLGWYARTRNGQF
2. 310-366 MSGLSCILKTCTQRKDLCG
3. 339-431 MHPEEGPLWMTISRWFYFWRIIIANVNYMGH
4. 515-544 MRWRPSCILF
5. 412-564 MSIIWVTKVASLISPRGNFCNIISALQKPSILSLHAMETIMHTFLTLFYGL
6. 557-682 MDFDTGLEVELLPLLIRARQSHCIFSFNTVWGRRHSYNVMNG
7. 678-716 MDDALCVCTKHLC
8. 713-742 MLITFASVLY
9. 646-777 MGKKTLLQCDEWMMPCVFVQNIYANNICQCALLRQCDAACFNKS
10. 755-838 MLLALISLKGINFMSCTVYCQLCLSVRL
11. 1035-1073 MDIFSTCIKHKIK
12. 938-1081 MDQNKLNVHWLQDCLNMQVIQFASLINKISKQDGYIFNMYQAQNKINA

Variant Information


Variant PositionrsIDReferenceAlternate
6028326 rs179418467 A G
6028486 rs179418427 G A
6028489 rs179418472 T G
6028539 rs179418155 A G
6028551 rs179418517 G A
6028672 rs41103409 C T
6028677 rs40691937 T C
6028694 rs179418404 T G
6028736 rs40657626 C A
6029031 rs179418580 G C
6029042 rs179418141 T C
6029119 rs179418681 C A
6029122 rs179418699 T A

References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: