Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001575

Transcript Name: hrid13
Type: lincRNA
Genomic Location: chr4:5325720-5328832
Nearest Gene: mapk11 (NM_001002095)


hrid13
Exons
53257205328832






Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 0 0 0.77 0.9 1.05 0.79 0.78 0.63 1.01 1.37 0.69 0 0 -0.68 0



Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 310-363 MCVVFDQRFGFVTQIILV
2. 442-477 MLHKLVLELGAD
3. 414-635 MHIYKVNKLYVAQVSPGTRSGLILRPNSIETVHSLYHSACACLRVPDRRSVYCWRRIYISCQSLRRHTFAEELL
4. 701-748 MIIMLKQKIEDIYWDK
5. 953-985 MHLISVVCSLT
6. 985-1017 MKLIIRRRLIM
7. 1030-1095 MMDVSLSAPALRTESVDAASGK
8. 1079-1138 MQHLVNNLLMCCFVLLDVFW
9. 1128-1238 MSSGDGSTLISVHYAAHVVSLSSLMDSVQLMQLSETR
10. 1264-1308 MCRIWKYSFTCELKP
11. 1308-1388 MRKRKVVLHHILTDEALTLHSLPIMST
12. 1450-1491 MISEAERFPSGIMF
13. 1538-1609 MTVIRKNCSIYDCQSSQIELITVT
14. 1569-1640 MTVRAVRLSSLLSPDLQIINYCCR
15. 1808-1909 MLMCVCVRRTDTVRSMRSALGLIRILRQAESTNI
16. 1695-1973 MASNYYEKPLMEINGYSIIYIPLSSCPYLLLLKVRKTACLCACVCGAQTQSEACGLHLVSFAYCDRQRAQTSKVINVSALMFKQVSKRSDYSY
17. 2073-2114 MINKTTRKSLSALD
18. 2156-2263 MLKAVFHIFILLYLFLFAGRKVIYAVEVRIISPPEY
19. 2226-2324 MQLKSELSALLNISNPFPPQFLFNEKFFFSTHF
20. 2296-2364 MKSFFFLHISNHNSFNNSFLITD
21. 2381-2452 MMTVHYIFKYKHSNSKCDSNALLG
22. 2616-2723 MLLKFLALLNIIWEILIFFKFSGALIILTSTNNRLE
23. 1695-1952 MASNYYEKPLMEINGYSIIYIPLSSCPYLLLLKVRKTACLCACVCGAQTQSEACGLHLVSFAYCDRQRAQTSKVINVSALMFKQVS

Variant Information


Variant PositionrsIDReferenceAlternate
5327323 rs40913678 C A
5327395 rs41185418 C T

References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: