Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001574

Transcript Name: lnc2_si:dkey-14d8.2
Type: lincRNA
Genomic Location: chr4:5295514-5328764
Nearest Gene: si:dkey-14d8.2 (NM_001044868)


lnc2_si:dkey-14d8.2
Exons
52955145328764





Expression Information

Negligible Expression across RNA-Seq datasets





Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 242-295 MCVVFDQRFGFVTQIILV
2. 374-409 MLHKLVLELGAD
3. 346-567 MHIYKVNKLYVAQVSPGTRSGLILRPNSIETVHSLYHSACACLRVPDRRSVYCWRRIYISCQSLRRHTFAEELL
4. 633-680 MIIMLKQKIEDIYWDK
5. 885-917 MHLISVVCSLT
6. 917-949 MKLIIRRRLIM
7. 962-1027 MMDVSLSAPALRTESVDAASGK
8. 1011-1070 MQHLVNNLLMCCFVLLDVFW
9. 1060-1170 MSSGDGSTLISVHYAAHVVSLSSLMDSVQLMQLSETR
10. 1196-1240 MCRIWKYSFTCELKP
11. 1240-1320 MRKRKVVLHHILTDEALTLHSLPIMST
12. 1382-1423 MISEAERFPSGIMF
13. 1470-1541 MTVIRKNCSIYDCQSSQIELITVT
14. 1501-1572 MTVRAVRLSSLLSPDLQIINYCCR
15. 1740-1841 MLMCVCVRRTDTVRSMRSALGLIRILRQAESTNI
16. 1627-1905 MASNYYEKPLMEINGYSIIYIPLSSCPYLLLLKVRKTACLCACVCGAQTQSEACGLHLVSFAYCDRQRAQTSKVINVSALMFKQVSKRSDYSY
17. 2005-2046 MINKTTRKSLSALD
18. 2088-2195 MLKAVFHIFILLYLFLFAGRKVIYAVEVRIISPPEY
19. 2158-2256 MQLKSELSALLNISNPFPPQFLFNEKFFFSTHF
20. 2228-2296 MKSFFFLHISNHNSFNNSFLITD
21. 2313-2384 MMTVHYIFKYKHSNSKCDSNALLG
22. 2548-2655 MLLKFLALLNIIWEILIFFKFSGALIILTSTNNRLE
23. 3059-3094 MFLPSGSSRRLF
24. 3149-3178 MLFNNSAHLF
25. 3509-3544 MSVISVLYRKHR
26. 3558-3647 MICSFVSLNSSGGKALRFNPGSPEFRSCYC
27. 3760-3864 MWVQTLTNLLSNHSSGQQSSISSSRCSDRRSVALW
28. 3935-4054 MVSECEARLKKGGYQFGLPLELPEPCPAGVILYSLPKNLK
29. 4054-4182 MNCIKILDLRPFPTRFGYHHLLSRGVTLHKANDGNRHVEQTHT
30. 4148-4210 MMVTDMWNRHTHDLHHLCSSR
31. 4210-4308 MIIISTVSVCPHVSASVQQAYSPEDSAVKTEIH
32. 4182-4328 MIYITCAAADDHHQYSQCLSTRLCFCSTGLQSRRFCSQDRNTLIHTYLL
33. 4450-4521 MLHQCFTVHFGVKYSFTAQNSNTE
34. 4583-4657 MKRKEQRSLTSAKCPSSHVFHIWTL
35. 4821-4856 MHRNNYQHICCT
36. 4856-4912 MRKSTYCRLSRVTSSSPPL
37. 5109-5177 MTQLNKLNGHGFICTGCYMKNMI
38. 5206-5349 MNQTVKCDHGTVRISGSNQKCSFPSAPQGGESGFTFSLTPFNDGRHDA
39. 5352-5393 MKTTTHADPAELIQ
40. 5330-5440 MMDDMTLDENNNTCRSCRINTIMTLKQLISLLICTLI
41. 5460-5498 MEESSMSTRFTSE
42. 5648-5746 MFAGVCCLCKSLVVMFCWSDRLRVFSLGLVDRN
43. 5772-5831 MLLTHTHSRQASNTLTEGGK
44. 5861-5890 MSVLWPVRVI
45. 5949-6035 MEHYCNIPSLCLMLHVLYEILTEIFLNYR
46. 6065-6145 MSECLYRITDVLWSVKQSCVCVCVDRL
47. 6176-6208 MQKYLHRRAKS
48. 6336-6365 MCNICVFVYC
49. 6391-6432 MCVDSTGSVKCCGL
50. 6521-6601 MCVIVCVFVLHMSVTIICFVEGHSSTK
51. 6484-6666 MMIICCCTGDVDHVCDCVCVCLAHVGYHHLLCGGSLLYKVNDGNRNGWGRDEGPEFLYSSF
52. 6605-6685 MMVTETGGEGTKVQNFYTVHFKFFARL
53. 6947-7021 MSDLNPCLYECLPQRTCVYSLINHH
54. 6972-7076 MSVFLRELVFIHSSTIISFTSASIILMNIMNSVGH
55. 7082-7225 MGRFEPGSPRLKLDTLRPEPLSLDSKGEVRLGLYHYSHTDQGLTHVSL
56. 7215-7280 MFLCNLGHEKPFGKCQTLWLKG
57. 7256-7354 MSNPVAQRMSVRLLFRSVKDRISFLPNRDTSQI
58. 7370-7441 MSLFLRELVFIYPSWVSFHHQGSV
59. 7411-7494 MGFLPSSGVSIMRSRWTLAIVRFEPGSP
60. 7558-7611 MRLYHCFHHEQGLTNISL
61. 7642-7779 MSSPVVQWMSLCLTYRRHGFKSHYCLLYFRLLEFNQTVWPKQQLTD
62. 7864-8052 MSGSHRCKCKVIRVGTHTQNYYVVFLIISAVKAAAVLGFEPRYAVTASDVMLCALTTTPSPHT
63. 8179-8214 MRIYYYISLFKM
64. 8246-8287 MNMFQIILQLLVGL
65. 8291-8485 MSLNTIKHCKYHHLPLKSPHTVLMTLHQIWPITCSLQKVPPPTYTRQSSSTTNTLSGLSTGNMSS
66. 8520-8552 MWRSVWRSISC
67. 8389-8676 MLSTESPSPNIHATEQQHNKHTFWTLYWKYELINTFTGAVNPPGCGGVCGGASAVERRSKICCRNTTNTRVYLHCCRGERERAMTEHKHYSNITTN
68. 8788-8919 MSLALSCHLLLELNLTPLKPCTWADLVSLLSKLFRLKEQLADAA
69. 9027-9167 MQSQLANPSLHADTIGERLTKSASCRIHKIFYIRSLRFHSATEILII
70. 8912-9196 MPPSGANGICALMHIQIPPLTMTSFASLSAASDIVSLIYAVSACKSKSACRYYWRKTDQICLLQNSQDFLHPLIAFSFSNRNTHNLKLIERLNTI
71. 9313-9372 MKTFCIPNIRARQTSSMCLY
72. 9375-9437 MSGALITYRLIFRFHITFVLV
73. 9883-9954 MGHSSTTSTFSLVKLSKKTCSKLT
74. 10110-10154 MKAVKHCLRSFLFLV
75. 10058-10210 MSIPAHLNIQLIFLNDINEGSQTLSKIIFVSSLTKYFHNINNSYTFVSEIN
76. 10345-10434 MCDENFLNVFNNVCGDGNDISTVYYENNEK
77. 10367-10447 MFLIMCVVMEMTFQQFIMKIMKNSFTD
78. 10474-10545 MYTKHSYLPSFCFGFKFFLSRFDC
79. 10587-10628 MFGYLIKGHKSARS
80. 10865-10897 MTSVYSSFAVI
81. 10937-10975 MISLYLIIIIFLV
82. 11014-11148 MFLVVSISGGKYTELQLRHRKVKSQCFTFAVLKFRKNISTIFQIN
83. 11195-11290 MFKFILLDLQWCHSPKSPHEGEHLEFIKLAVV
84. 11520-11636 MCVFVCRLYRISEVLWTVSLLNRSRDVWTDTDDHLLLHR
85. 11648-11680 MCMIVCVCVCV
86. 11689-11736 MSVTIICFVEGHSSTK
87. 11740-11820 MMVTETGGEGTQVQNFYTVHFKFFGRL
88. 12083-12157 MSDLNPCLYESLPQRTCVYSLINHH
89. 12108-12212 MSLFLRELVFIHSSTIISFTSASIILMNIMNSVGH
90. 12218-12361 MVRFEPGSPRLKLDTLRPEPLSLDSKGVVRLGLYHYSHTDQCLTHVSL
91. 12351-12416 MFLCNLGHEKPFAKCQTLWLKG
92. 12340-12435 MFDTCFFVIWATKNLSPNVKPCGSKDERSPAI
93. 12392-12490 MSNPVAQRMSVRLLFRSVKDRISFLPNRDTSQI
94. 12547-12621 MGFVPSSGAPGQYNEVKMDISHSEV
95. 12506-12637 MSLFLRELVFIYPSWVSFHHQGLLVSIMRSRWTLAIVRFKPGSP
96. 12691-12726 MCLNEALSLFSS
97. 12701-12754 MRLYHCFHHEQGLTNISL
98. 12785-12922 MSSPVVQWMSLCLTYRRHGFKSHYCLLYFRLLEFNQTVWPKQQLTD
99. 12992-13060 MKPTSMSGSHHYKCKVIRVGTHT
100. 13157-13195 MLCALTTSPSPHI
101. 13322-13357 MRIYYYISLFKM
102. 13389-13430 MNMFQIILQLLVGL
103. 13434-13628 MSLNTIKHCKYHDLPLKSPHTVLRTLHQIWPITCFLQKVPPPTYTRQSSSTTNTLSGLSTGNMSS
104. 13663-13695 MWRSVWRSVSC
105. 13532-13819 MLSTESPSPNIHATEQQHNKHTFWTLYWKYELINTFTGAVNPPGCGGVCGGASAVERRSKICSRNTTNTRVYLHCCRGERERAMTEHKHYSNITTN
106. 13931-14032 MSLALSCHLLLELNLLVKRCTCVDLCCCCQSCSD
107. 14230-14301 MPLAEFTRFFTSAHCVFIQQQKYS
108. 14166-14306 MQSHLANPSLHADTIGERLTKYASCRIHKIFYIRSLRFHSATEILII
109. 14051-14335 MPPSGANGICALMHIQTPPLTMTSFASLSAASDIVSLIYAVSSCKSKSACRYYWRKTDQICLLQNSQDFLHPLIAFSFSNRNTHNLKVIERLNTI
110. 14452-14511 MKTFCIPNIRARQTSSMCLY
111. 14514-14576 MSGALITYRLIFRFHITFVLV
112. 14651-14710 MIKEVKLVLYSHILTFPLII
113. 14752-14802 MILAANDYQSTTLFIVK
114. 14815-14865 MLFSSHTCMLILIEYSK
115. 14904-14939 MCEYKTNFTSIE
116. 14896-14943 MNECVNIKPTLPLLND
117. 15015-15086 MTAVSDQEKTLSRRLNKIKRIYRR
118. 15309-15380 MGHSSTTGTFSLVKLSKKTCSKLT
119. 15536-15580 MKAVKHCLRSFLFLV
120. 15484-15636 MSIPAHLNIQLIFLNDINEGSQTLSKIIFVSSLTKYFHNINNSYTFVSEIN
121. 15771-15860 MCDENFLNVFNNVCGDGNDISTVYYENNEK
122. 15793-15873 MFLIMCVVMEMTFQQFIMKIMKNSFTD
123. 15900-15953 MYTKHSYLSSFCFGFTFF
124. 16012-16053 MFGYLIKGHKSARS
125. 16240-16269 MKTENDFAVI
126. 16309-16347 MISLYSIIIIFLV
127. 16386-16424 MFLVVSISGGKYT
128. 16567-16662 MFKFILLDLQWCHSPKSPHEGEHLEFINFAVV
129. 16890-17018 MCVFVCRLYRISEVLWTVSLLNRSRDVWTDTDCTDDDHLLLHR
130. 16993-17034 MMIICCCTGDVDHV
131. 17059-17106 MSVTIICFVEGHSSTK
132. 17030-17110 MCDCVCLSCTCRLPSFALWRVTPLQSK
133. 17110-17190 MMVTETGGEGTKVQNFYTVHFKFFGRL
134. 17341-17382 MGQRSYHRATDLLV
135. 17452-17526 MSDLNPCLYESLPQRTCVYSLINHH
136. 17477-17581 MSLFLRELVFIHSSTIISFTSASIILMNIMNSVGH
137. 17587-17730 MVRFEPWSPRLKLDTLRPEPLSLDSKGEVRLGLYHYSHTHQGLTHVSL
138. 17720-17785 MFLCNLGHKKPFGKCQTLWLKG
139. 17761-17859 MSNPVAQRMSVRLLFRSVKDRISFLPNRDTSQI
140. 17916-17954 MGFTSIIRGSWSV
141. 17875-17991 MSLFLRELVFIYPSWVSRPSSGAPGQYNEVKMDISHSEV
142. 17957-18007 MRSRWTLAIVRFEPGSP
143. 18061-18096 MCLNEALSLFSS
144. 18071-18124 MRLYHCFHHEQGLTNISL
145. 18155-18268 MSSPVVQWMSLRLTYRRHGFKSHYCLLYFRLLEFNQTV
146. 18377-18493 MSGSHRCKCKVIRVGTHTQNYYVVFLIISAVKSSSSAWI
147. 18528-18566 MLCALTTSPSPHT
148. 18760-18801 MNMFQIILQLLVGL
149. 18805-18999 MSLNTIKHCKYHHLLLKSPHTVLMTLHQIWPITCSLQKVPPPTYTRQSSSTTNTLSGLSTGNMSS
150. 19034-19066 MWRSVWRSISC
151. 18903-19151 MLSTESPSPNIHATEQQHNKHTFWTLYWKYELINTFTGAVNPPGCGGVCGGASAVERRSKICCRNTTNTRVYLHCCRGGESND
152. 19147-19185 MTEHKHYNNITTN
153. 19297-19362 MSLALSCHLLLELNLTPVKPCT
154. 19536-19676 MQSQLANPSLHADTIGERLTKSASCRIHKIFYIRSLRFHSATEILII
155. 19421-19705 MPPSGANGICALMHIQTPPLTMTSFASLSAASDIVSLIYAVSACKSKSACRYYWRKTDQICLLQNSQDFLHPLIAFSFSNRNTHNLKLIERLNTI
156. 19822-19881 MKTFCIPNIRARQTSSMCLY
157. 19884-19946 MSGALITYRLIFRFHITFVLV
158. 20127-20192 MGHSSTTSTFSLVKLSKKTCSK
159. 20354-20398 MKAVKHCLRSFLFLV
160. 20302-20454 MSIPAHLNIQLIFLNDINEGSQTLSKIIFVSSLTKSLHNINNSYTFVSEIN
161. 20589-20678 MCDENFLNVFNNVCGDGNDISTVYYENNEK
162. 20611-20691 MFLIMCVVMEMTFQQFIMKIMKNSFTD
163. 20718-20771 MYTKHSYLPSFCFGFRFF
164. 20830-20871 MLGYLIKGHKSARS
165. 21058-21108 MKTENDSLQQEADLCSR
166. 21108-21140 MTSVYSSFAVI
167. 21180-21218 MISLYSIIIIFLV
168. 21257-21406 MFLVVSISGGKYTELQLRHRKVKSQCFTFAVLKFRKNINTNFQINTSAKV
169. 21438-21533 MFKFILLCLQWCHSPKSPHEGEHLEFINFAVV
170. 21458-21577 MFAVVSFTKITTRGRTFRIHQFRSGVIQKYLHRREKLSLF
171. 21862-21903 MTIICCCTGDVDHV
172. 21924-21971 MSVTIICFVEGHSSTK
173. 21899-22036 MCDCVCLAHVGYHHLLCGGSLLYKVNDGNRNGWGRDEGPEFLYSSF
174. 21975-22055 MMVTETGGEGTKVQNFYTVHFKFFGRL
175. 22317-22391 MSDLNPCLYESLPQRTCVYSLINHH
176. 22342-22446 MSLFLRELVFIHSSTIISFTSASIILMNIMNSVGH
177. 22452-22595 MVRFEPGSPRLKLNTLRPEPLSLDSKGEVRLGLYHYSHTDQGLTHVSL
178. 22585-22650 MFLCNLGHEKPFGKCQTQWLKG
179. 22626-22724 MSNPVAQRMSIRLLFRSVKDRISFLPNRDTSQI
180. 22781-22855 MGFVPSSGAPGQYNEVKMDISHSEV
181. 22740-22871 MSLFLRELVFIYPSWVSFHHQGLLVSIMRSRWTLAIVRFEPGSP
182. 22935-22988 MRLYHCFHHEQGLTNISL
183. 23071-23148 MGSNPTIAYFTFGCWNSIRQCGPNSI
184. 23019-23156 MSSPVVQWMSLCLTYRRHGFKSHYCLLYFRLLEFNQTVWPKQHLTD
185. 23241-23294 MSGSHHYKCKVIRVGTHT
186. 23392-23430 MLCALTTSPSPHT
187. 23561-23596 MQIYYYISLFKM
188. 23628-23669 MNMFQIILQLLVGL
189. 23673-23867 MLPNTIKHCKYHHLPQKSPHTVLMTLHQIWPITCSLQKVPPPTYTRQSSSTTNTLSGLSTGNMSS
190. 23902-23934 MWRSVWRSISC
191. 23771-24019 MLSTESPSPNIHATEQQHNKHTFWTLYWKYELINTFTGAVNPPGCGGVCGGASAVERRSKICCRNTTNTRVYLHCCRGGESND
192. 24015-24053 MTEHKHYNNITTN
193. 24165-24230 MSLALSCHLLLELNLTPVKPCT
194. 24404-24544 MQSQLANPSLHADTIGERLTKSASCRIHKIFYIRSLRFHSATEILII
195. 24289-24573 MPPSGANGICALMHIQTPPLTMTSFASLSAASDIVSLIYAVSACKSKSACRYYWRKTDQICLLQNSQDFLHPLIAFSFSNRNTHNLKLIERLNTI
196. 24690-24749 MKTFCIPNIRARQTSSVCLY
197. 24752-24814 MSGALITYRLIFRFHITFVLV
198. 24995-25060 MGHSSTTSTFSLVKLSKKTCSK
199. 25222-25266 MKAVKHCLRSFLFLV
200. 25170-25322 MSIPAHLNIQLIFLNDINEGSQTLSKIIFVSSLTKSLHNINNSYTFVSEIN
201. 25457-25546 MCDENFLNVFNNVCGDGNDISTVYYENNEK
202. 25479-25559 MFLIMCVVMEMTFQQFIMKIMKNSFTD
203. 25586-25639 MYTKHSYLPSFCFGFRFF
204. 25698-25739 MLGYLIKGHKSARS
205. 25926-25976 MKTENDSLQQEADLCSR
206. 25976-26008 MTSVYSSFAVI
207. 26048-26086 MISLYSIIIIFLV
208. 26125-26274 MFLVVSISGGKYTELQLRHRKVKSQCFTFAVLKFRKNINTNFQINTSAKV
209. 26306-26401 MFKFILLCLQWCHSPKSPHEGEHLEFINFAVV
210. 26326-26445 MFAVVSFTKITTRGRTFRIHQFRSGVIQKYLHRREKLSLF
211. 26730-26771 MTIICCCTGDVDHV
212. 26792-26839 MSVTIICFVEGHSSTK
213. 26767-26904 MCDCVCLAHVGYHHLLCGGSLLYKVNDGNRNGWGRDEGPEFLYSSF
214. 26843-26923 MMVTETGGEGTKVQNFYTVHFKFFGRL
215. 27185-27259 MSDLNPCLYESLPQRTCVYSLINHH
216. 27210-27314 MSLFLRELVFIHSSTIISFTSASIILMNIMNSVGH
217. 27320-27463 MVRFEPGSPRLKLNTLRPEPLSLDSKGEVRLGLYHYSHTDQGLTHVSL
218. 27453-27518 MFLCNLGHEKPFGKCQTQWLKG
219. 27494-27592 MSNPVAQRMSIRLLFRSVKDRISFLPNRDTSQI
220. 27649-27723 MGFVPSSGAPGQYDEVKMDISHSEV
221. 27608-27739 MSLFLRELVFIHPSWVSFHHQGLLVSMMRSRWTLAIVRFEPGSP
222. 27803-27856 MRLYHCFHHEQGLTNISL
223. 27939-28016 MGSNPTIAYFTFGCWNSIKQCGPNSS
224. 27887-28024 MSSPVVQWMSLCLTYRRHGFKSHYCLLYIRLLEFNQTVWPKQQLTD
225. 28109-28162 MSGSHHYKCKVIRVGTHT
226. 28260-28298 MLCALTTSPSPHT
227. 28427-28462 MQIYYYISLFKM
228. 28494-28535 MNMFQMILQLLVGL
229. 28539-28733 MSLNTIKHCKYHHLPLKSPHTVLMTLHQIWPITCSLQKVPPPTYTRQSSSTTNTLSGLSTGNMSS
230. 28768-28875 MWRSVWRSVRKRKDVQQKHNRHTCVSSLLQRRESNA
231. 28637-29008 MLSTESPSPNIHATEQQHNKHTFWTLYWKYELINTFTGAVNPPGCGGVCGGASERGKMCSRNTTDTRVYLHCCRGERAMPEHKHYNNITTNKPMKESHLQVSRVTLHYCTLCRFSSLSGCNICC
232. 29020-29115 MLLSCHLLELNLTPVKRCTCVDLCRCCQRCSG
233. 29249-29278 MNGLLQYIIF
234. 29134-29301 MPPSGADGNCALMPLAEFFFHPLVVFSYSNRNTYNSKLDEWLTTIYNLLKSSQSSL
235. 29350-29394 MKTFCIPNIRASQIN
236. 29398-29454 MCLLIRDALITYRLNDDLE
237. 29441-29485 MTIWSEEHHSEKVTS
238. 29571-29624 MLHLYWFDISTMLINNLS
239. 29661-29690 MNDQMFEFKL
240. 29665-29697 MIRCLSLSFKR
241. 29724-29822 MLLGGKLTGETKKKTQLCRIQKYLHRREKLSAF
242. 30143-30220 MCVIVCVCVFVPHVGYHHLLCGGSLL
243. 30180-30227 MSVTIICFVEGHSSRK
244. 30106-30231 MMIICCCTGDVDHVCDCVCVCVCSTCRLPSFALWRVTPLESK
245. 30231-30311 MMVTETGGEGTQVQNFYTVHFKFFGRL
246. 30630-30659 MRSDMMSSYH
247. 30721-30795 MSCDFIINMLKIPRALRRDLISGPL
248. 30699-30824 MFDSSPVDELRFHYKYVKDPSCSEEGFDLRSSVRVQSSCHVL
249. 30817-30870 MCSDHWTIISHTNAGASG
250. 30812-30898 MPCALTTGPSSATLMQELLVNTSTFLDVK
251. 30891-30932 MSNRKKNKEENTIK
252. 31125-31169 MCSSLQHSNMIILTQ
253. 31179-31313 MNAETHPLLKVLAFKRLCFSCCSLNLEVYDASKASAPLKDRRLHL
254. 31361-31489 MCSVAAGGVSLCVCQCVTPSSGALENCSSGSTRAAAAHRRLKL
255. 31682-31735 MCVVFDQQFGFVTQIILV
256. 31817-31849 MHKLVQEFREE
257. 31786-32016 MHIYKENKLFDAQISPGVQRGVIFRPNNIETVHSLYHSACPCLRVPDRRSVYCWRRIYISCQSLRRHTFAEELLWDI
258. 32306-32338 MHLISVVCSLT
259. 32338-32370 MKLIIRRRLIM
260. 32383-32448 MMDVSLSAPALRTESVDAASGK
261. 32432-32491 MQHLVNNLLMCCFVLLDVFW
262. 32481-32591 MSSGNGSTLISVHYAAHVVSLSSLIDSVQLMQLSETR
263. 32617-32661 MCRIWKYSFTCELKP
264. 32661-32741 MRKRKVVLHHILTDEALTLHSLPIMST
265. 33169-33204 MLLPSGSSRRLF
266. 33259-33288 MLFNNSAHLF
267. 33736-33768 MSPLLCRKYIE

Variant Information


Variant PositionrsIDReferenceAlternate
5327323 rs40913678 C A
5327395 rs41185418 C T

References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: