Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001568

Transcript Name: lnc_ndufa5
Type: lincRNA
Genomic Location: chr4:4837087-4839596
Nearest Gene: ndufa5 (NM_001013456)


lnc_ndufa5
Exons
48370874839596






Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 0 0.26 -3.7 0 0 0.95 1.13 0 -4.52 0 1.1 -3.74 -3.31 0.55 0



Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 4-132 MCSVAAGGVSLCVCQCVTPSSGALENCSSGSTRAAAAHRRLKL
2. 325-378 MCVVFDQRFGFVTQIILV
3. 429-512 MHIYKANKLYVAQVSPGVQRSNIQTEQH
4. 457-723 MLHKLVQEFRGVIFRPNNIDTVHSLYHSACLCLRVPDRRSVYNIDTVHSLYHSACLCLRVPDRRSVYCWRRIYISCQSLRRHTFAEELL
5. 789-827 MIIMLKQKKENIY
6. 1022-1054 MHLISVVCSLT
7. 1054-1086 MKLIIRRRLIM
8. 1099-1164 MMDVSLSDPALRTESVDAASGK
9. 1148-1207 MQHLVNNLLMCCFVLLDVFW
10. 1197-1307 MSSGDGSTLISVHYAAHVVSLSSLMDSVQLMQLSETC
11. 1304-1369 MLRISRREKPCAGSGNTALHVN
12. 1333-1377 MCRIWKYSFTCELKP
13. 1377-1457 MRKRKVVLHHILTDEALTLHSLPIMST
14. 1519-1560 MISEAERFPSGIMF
15. 1638-1709 MTVRAVRLSSLLSPHLQIINYCCR
16. 2065-2094 MSDDLMSADY
17. 2148-2198 MSDDYSCLMIIHVCHLN
18. 2165-2230 MSDDYSCLSSKLSLLIWSDRIS
19. 2240-2275 MLLPSGSSRRLF
20. 2330-2359 MLFNISAHLF
21. 2323-2421 MIDAFQYFSSFVLKISLNYIVDSSHQRPLVEKH
22. 2564-2641 MKDSEFNESVIQKQHHCILEICLTYV
23. 2637-2687 MFESRLLFTLLYFPSVL

Variant Information


Variant PositionrsIDReferenceAlternate
4839448 rs41177758 A G

References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: