Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001561

Transcript Name: arid2oa2
Type: Overlapping
Genomic Location: chr4:1543082-1544564
Nearest Gene: arid2 (NM_001077763)


arid2oa2
Exons
15430821544564



Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 1.13 1.34 1.17 1.8 1.41 1.42 1.49 1.33 1.57 2.17 -2.83 -2.82 1.95 1.13 0



Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 64-117 MLRSAPLRRGCVFEKLKK
2. 117-191 MTEDESGETRSSGSPSSPRTRASSA
3. 127-432 MRVEKPAPAAARAAREPERAQPNCTAALLMAARGNDGTGCACVGVWSGFLTVRDGRGSGLIAHTVKRQRDPVQTKRPEAARLHGASSRPTTVLQPPQRRCEQ
4. 548-649 MKIIKLESKVVSGRVKSPQLRQTVMRRSVNECLF
5. 636-689 MNVCFKIQSRVVMTTSIH
6. 778-813 MFKDLSSSKKQY
7. 1031-1189 MAELDAKDPILSSRRHEQLEKAEFNISNAVFSELWMFFSAPADMLWRRAADGE
8. 1182-1211 MENNVRALWL
9. 1192-1236 MCARSGFDAARALSG
10. 1352-1396 MICWYCAGCFVFGKY

Variant Information


Variant PositionrsIDReferenceAlternate
1543126 rs179389219 T C
1544453 rs40768655 C A

References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: