Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC001560

Transcript Name: arid2oa1
Type: Overlapping
Genomic Location: chr4:1543082-1544403
Nearest Gene: arid2 (NM_001077763)


arid2oa1
Exons
15430821544403



Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 3.02 3.04 2.7 2.26 2.19 1.56 1.09 1.27 1.35 1.94 2.07 2.1 1.92 2.03 2.27



Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 64-117 MLRSAPLRRGCVFEKLKK
2. 117-191 MTEDESGETRSSGSPSSPRTRASSA
3. 127-432 MRVEKPAPAAARAAREPERAQPNCTAALLMAARGNDGTGCACVGVWSGFLTVRDGRGSGLIAHTVKRQRDPVQTKRPEAARLHGASSRPTTVLQPPQRRCEQ
4. 548-649 MKIIKLESKVVSGRVKSPQLRQTVMRRSVNECLF
5. 636-689 MNVCFKIQSRVVMTTSIH
6. 778-813 MFKDLSSSKKQY
7. 1031-1189 MAELDAKDPILSSRRHEQLEKAEFNISNAVFSELWMFFSAPADMLWRRAADGE
8. 1182-1211 MENNVRALWL
9. 1192-1236 MCARSGFDAARALSG
10. 1352-1396 MICWYCAGCFVFGKY

Variant Information


Variant PositionrsIDReferenceAlternate
1543126 rs179389219 T C

References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: