Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC000729

Transcript Name: mstx131
Alias: megamind
Type: lincRNA
Genomic Location: chr17:22517186-22519802
Nearest Gene: ttc27 (NM_173285)


mstx131
Exons
2251718622519802





Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 0.67 0.95 0.17 0.53 0.79 1.37 2.09 2.19 2.24 0.7 1.03 1.01 2.45 1.23 0



Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 159-299 MHGALRLRDGTYNHTTAIGYGQRTAGWGARSHRSPISRASGGIHAHL
2. 154-447 MQCTALSGSETGPITTRLPSATDRERQGGELAATDRQSPEHPEASTHICRASTPTEKAERKRRERNHGGGKGEKVGASFSTNAETPHFHMLKGSDRQE
3. 616-657 MKGVRRPSKEQKNK
4. 667-729 MRRRINEDLNERGTKGMAGDV
5. 695-799 MSVEQKEWLVMCKEAGILTQKQREKARGREREKER
6. 1006-1050 MRPQHAGSSPRSPTP
7. 951-1055 MFGHLALMLPPAQICISCDETTACWIFPQISHAVG
8. 1111-1149 MCQTVYKACCPHC
9. 1019-1156 MLDLPPDLPRRRVRLPIFILYLLLSSVPSTVCVRLSTRLVVHIAEL
10. 1185-1244 MFWYLEADTSTCAPMNMVPS
11. 1333-1374 MDSKSSQLPRVALL
12. 1166-1573 MMFIEMNVLVSGSRHFHMCSNEHGTKLNRKLRKDGMRKEKSFSVHGRGKQQVRWLKWIVNHLSCQESPCCSSSAGKYHFLRGKSITEVRGRHPLLCSLRHTRSWAISVEGNLTLGVASLSVWSGLWMSTTGGHLRT
13. 1584-1616 MEPQKLPLLVD
14. 1630-1836 MLLSCFSTDKHPGDRGGGVRMGTTTVSIEEVRAQEGKEEREESILALLGIIGTFLNLFVIVFVYIYTTL
15. 1887-1928 MTAGLMSYREDGGR
16. 1928-1957 MTLGSVSQRQ
17. 1918-1971 MVEDDTGQRQSETVTLTL
18. 2010-2063 MSVQNRSLDIKRTNHGYT
19. 2053-2151 MDTPDLHPCRMWSPAKGQYVSPATEITSSTAWL
20. 2006-2284 MDVSSKQISGHKENESWIHLICILAGCGHQPKDSMFPQQLKLHRALPGCDYKDAHRERPYWTNKNVTGQQNISFRICPPIEKKICNKMEKREV
21. 2163-2300 MHIGKDPTGQTRTSQGNRTSPSEFAHQLKKKSAIKWKNGKYEIFFY
22. 2284-2334 MKYFSIKRELTEKNDRL
23. 2370-2426 MGTGSSQIFGHFFTTVPPF
24. 2324-2485 MIDSETHLQFSNSGPYGNRQFADIWTLFHYSSSFLTAGRINRQIMSVRVCVFSL
25. 2564-2614 MYCAIDNLINKIIFYGS

Variant Information


Variant PositionrsIDReferenceAlternate
22517466 rs41231434 T C
22517515 rs40767011 T G
22517546 rs40899644 G GT
22517555 rs40947088 T TT
22517573 rs40831335 T A
22517576 rs40714738 G A
22517641 rs40993439 C T
22517857 rs40823121 T A
22517860 rs41119418 C T
22519693 rs40753343 G A

References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: