Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC000480

Transcript Name: ykrt33
Alias: malat1
Type: lincRNA
Genomic Location: chr14:48566284-48574855
Nearest Gene: zgc:194285 (NM_001135980)


ykrt33
Exons
4856628448574855



Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 0.66 0.22 0.87 1.67 0.25 2.26 0 1.82 2.94 1.18 0 0 1.62 1.77 2.77



Mutant Information


ChromosomeMutant PositionZFIN ID

No retroviral insertion mapping detected




Predicted Open Reading Frames


ORFRangeSequence
1. 258-299 MWHACAFWQCSKKE
2. 358-387 MFVFIRADGF
3. 446-475 MSVGFSLYVF
4. 426-509 MIHPGQLCPLVFHYTFFSGSKLLFAKFY
5. 554-631 MKGLDPLQMLTPVDQTKACLLGVSYT
6. 607-654 MFVGGFLYVISMASYF
7. 878-919 MTDFYFLGGGDYPF
8. 772-966 MGLFFLLNTKQDISKKLVQQKRNSSRFETSEMLSINDRFLFFGGGGLSLLNVWYVVSSIKHIYFI
9. 923-973 MCGMLCQVLNTYILYEL
10. 966-1016 MNYKIPIYYYSYIGNLT
11. 1146-1175 MEGREASLIW
12. 1367-1456 MRKNSFFVYLKKTKNVLFSRTFNVYLQVNV
13. 1502-1582 MAKRTLSFSLNLILSLFLFQQGFSEIT
14. 1697-1732 MISLLFSSQNNQ
15. 1840-1884 MVTVRTQGIYNHFNL
16. 1955-2014 MVVRSNSKSFFSILILRLVS
17. 2062-2223 MEGKRLQGYSRFYSRKKKFIFLSFRLTSKTTNDHFSTARKSIFKLQTFLKKYIF
18. 2329-2367 MMANILKMYFFLL
19. 2383-2424 MLQVYYGSKQKKSF
20. 2399-2443 MVVNKKNLFNMPAIM
21. 2447-2485 MCYNFIMNPNQFY
22. 2678-2752 MVRIKKKNTITEDFSFLFSLHTLKV
23. 3010-3093 MIVRVRLSTVEVNSRFLFIFFWERKLLI
24. 3197-3334 MQYLHFYLFICKPYPRNEEQLLIARVPFLRDFILFFAYHNRTITNA
25. 3403-3519 MQYLHFYLFICKPYPRNEEQLLIARVTFIRDFYFVFCIP
26. 3703-3780 MLPPFFFFFFFSFFFLRRRRIEYFKI
27. 3813-3845 MMLFFSTEPRN
28. 3868-3897 MLSNSSEMEA
29. 3910-3963 MIQRYQQKTDVQRTGEMD
30. 3938-3976 MCRGQEKWTEFIQ
31. 4005-4145 MEEKDLQQGPGRIRTRKDLQQGPGPGRIRTRWRARQNQGRIRGHRSG
32. 3995-4210 MTSDGRKRSTAGTRENQDKKRSTAGARTRENQDKVASQAEPGEDQRAQIRVKRSSIQKGEPGLQGRVASDPR
33. 4258-4323 MGVPKAAGERGLTSRGYQGSLP
34. 4334-4375 MRRAFGLYGLRYSV
35. 4477-4518 MASVPLLAKSDECR
36. 4460-4576 MFENPIWHLSRCWPSLMNAVSVLRRRSSLFDHASAEIWL
37. 4512-4610 MPLVCCGDDRPYSTTPPLRFGYRPVEKSSPISA
38. 4736-4768 MMPGQPHIACR
39. 4669-4776 MFDCVPTRHHYLYCNTRCVSPTYDARAAAYCLPVKF
40. 4779-4910 MSSCMNFYCNLEQKLCIFKKKKKKKKRKEKKYIQYVFAKVNALL
41. 4900-5091 MRYCKIINIQMLQMHFLSSYVMLLQCFWGLGGANSFLEFSFPQALFTLEAIKPKRDSRMLCGPF
42. 5199-5291 MNYTFINIFQYYMLGFAMGWEGCGSLTQIFS
43. 5387-5440 MRGPVTSLPWQLDQRLHG
44. 5353-5475 MGKEPPVCLPVDAWPCYKPSMAARPTFTWVTRHGIKRFHFI
45. 5450-5509 MGSNAFILFNTSLWPFSYHY
46. 5436-5585 MGNAAWDQTLSFYLTHHYGHFPIIIELVFGYWLCIWILFMGFVDLGGGIA
47. 5488-5724 MAIFLSLLNWCLDIGCVFGYCLWGLWIWGGGLPNFDSYRLKQTLKEQSWWSNQYLLHFPHLSKASSLEVQMLLTFSNGK
48. 5746-5784 MAFICFCLSLYCT
49. 5717-5815 MASNCGYSCKWHSFAFVCRCIVLEYNLMAKCKQ
50. 5929-6042 MLSTEDVILTLFVKICFRIKQLQPLFGHVRSLSKSICF
51. 5871-6128 MCVGFLFLPLCIFQCAVSLNAFNRRCHPNIVCKDLLSHQATSASFRSRKVTKQVHLFLTFSIFNSLLQPVKCVVAHLLQISFVICI
52. 6201-6290 MHLFLGGMCGAFLGVSLCFFRYECKAWRFL
53. 6265-6309 MSVKLGAFCSLDARA
54. 6299-6400 MPGLDVNSVQGGEADQSSPTAVCEGGKANCIYKI
55. 6312-6413 MSTLCKVERQISPVLQQCAKEERQIVYTKFKDIP
56. 6475-6582 MFLLDHWVGVGVLLLCHLVLQNLAKALKIGTYQKKL
57. 6707-6775 MLYKCIAAVFISAVAQLCFRFQI
58. 6718-6840 MYSSSLYFSCRTTVLQIPNLKWLGTAAQLCSFIWHWLNSRT
59. 6854-6976 MCLGWERGSALFSLFCRNLISQLCGESYMMSPCGVCSYQVS
60. 7006-7083 MQLFINFSNINRQCFRSYTTFMLHAL
61. 7044-7124 MLQKLHYLYASCTLSFFYILTPQLSHS
62. 7076-7162 MHFKFLLHLNSSVESQLVLQSVCGGSVCV
63. 7279-7482 MANRIPPSVRLRALSKPWKPFAEVPLCVCASFFFLFIPHLPLQFFIFLGQFHLGSKIVLCPSGRTLTA
64. 7275-7505 MNGQSNPPFCALESFVQTLEALRRSPSVCLRVFFFSVYPPPPSPILHFLRSISFREQNCLVSVWENPNRLMKPIHSL
65. 7696-7734 MGQHFLSFQVRCL
66. 7632-7763 MHAHNTLNQTVSVCVLVALGRDGATLSLFSGTLFVIPLKIKAEP
67. 7768-7914 MGVDGCACVKAVTSTCIGFKVFFLKIVLGLGRGRGGCGLVNVLFFSLQL
68. 8074-8151 MVILQRRLFCSGRVGGNPRPGTVVWW
69. 8155-8244 MTFVSHLVMNLWGWVGWGGSKPFSVFQIFV
70. 8334-8429 MLHIEDKITTVISMGFEEFDWGFWGGNLQSFV
71. 8664-8720 MYLIKIVCFEGSVNGLFIF
72. 8704-8781 MDCLYFKVHLADVEQVLLKLILLLMA
73. 8937-9020 MSMGIENNGKLIKGSFLRTITCYNVYGQ
74. 9007-9045 MSMASEVIYLHEL
75. 9038-9076 MNCKVARSIYHFV
76. 9169-9267 MICSYQVSFCQPSESVIHYIALLFIRYVFICKN

Variant Information


Variant PositionrsIDReferenceAlternate
48566734 rs40907723 T A
48566935 rs40942563 A C
48567132 rs40943145 A G
48567134 rs41143849 C T
48567616 rs40855135 T C
48567639 rs40735772 G A
48567725 rs41111354 A T
48567883 rs41085547 A C
48568005 rs41020434 T C
48568016 rs40907834 T C
48568048 rs40823858 T A
48568111 rs41217247 A G
48569065 rs40833366 G A
48569993 rs179567491 C T
48569998 rs179567492 C T
48570142 rs40782800 T C
48570152 rs40770953 G A
48570260 rs40921901 A G
48570307 rs41121130 G C
48570359 rs40709919 C T
48570360 rs40818041 A G
48570364 rs41185005 A G
48570373 rs41061742 A T
48570382 rs41120605 C T
48570448 rs40601831 C T
48570467 rs40809738 A T
48570476 rs3728665 A C
48570584 rs40972678 T C
48570816 rs41009910 T C
48571316 rs41156749 G T
48571390 rs40788971 G A
48571575 rs40954744 A T
48571605 rs40756189 C A
48571606 rs41246921 C T
48571637 rs41004959 A T
48571665 rs41131955 G A
48571773 rs41130658 T G
48571792 rs40858745 T C
48571849 rs41047451 A G
48572107 rs41189461 C G
48572344 rs40882936 T C
48572348 rs41163802 A G
48572422 rs40817924 T C
48572436 rs41037674 G T
48572442 rs40963336 T G
48572481 rs41217122 G A
48572503 rs41108775 A G
48572613 rs40809489 A G
48572616 rs40984844 T C
48572627 rs40701790 A C
48572689 rs40985412 T C
48572741 rs41184022 T C
48572744 rs40911616 T C
48572757 rs41218383 T G
48572839 rs40717230 T C
48572841 rs41199128 A G
48572853 rs40956002 G T
48572861 rs40731411 A G
48572869 rs40791719 A G
48572932 rs40841979 A G
48572933 rs41166641 G T
48572990 rs41008200 G A
48573098 rs41174142 A T
48573128 rs41063099 T A
48573144 rs40891185 A G
48573178 rs41146550 A G
48573221 rs41190956 T G
48573222 rs40781873 A G
48573224 rs40633382 C T
48573280 rs40651269 T C
48573292 rs40658018 T C
48573293 rs41007877 T C
48573299 rs40996642 A G
48573303 rs40916469 A G
48573317 rs40647712 A G
48573326 rs40664434 A G
48573327 rs40644603 G A
48573328 rs41166540 T C
48573329 rs40643024 G C
48573333 rs40658790 A G
48573336 rs40674116 A G
48573338 rs40766827 A G
48573342 rs40653213 T C
48573347 rs40631005 T C
48573350 rs40646553 G A
48573359 rs40841149 A G
48573361 rs40671419 T C
48573362 rs40800085 C T
48573379 rs40673633 T C
48573381 rs40666923 C T
48573395 rs40663480 A G
48573399 rs40648767 A G
48573404 rs40636125 T A
48573415 rs40644534 A G
48573427 rs40660799 T C
48573455 rs40671418 T C
48573479 rs40673467 T C
48573486 rs40664699 T C
48573527 rs40665418 A G
48573543 rs40669515 T C
48573553 rs40651787 T C
48573558 rs40667662 C T
48573572 rs40677422 T C
48573576 rs40631006 T C
48573580 rs40652959 A G
48573586 rs40633383 G A
48573591 rs40647510 A G
48573623 rs40644325 A G
48573643 rs40636124 T C
48573659 rs40635653 A G
48573666 rs40664439 A G
48573671 rs40671538 G A

References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: