Transcript
      Expression
      Mutation
      Predicted ORFs
      Variation
      References

ZF_LNC000376

Transcript Name: tmem39bpa
Alias: cyrano
Type: Promoter
Genomic Location: chr13:33484734-33491201
Nearest Gene: tmem39b (NM_199860)


tmem39bpa
Exons
3348473433491201





Expression Information

log10FPKM values for lncRNA in different stages
  2-4 cell 1-K cell Dome Shield Bud 1 dpf 2 dpf 3 dpf 5 dpf Adult Heart Blood Brain Kidney Liver
log10FPKM values 1.78 1.75 2.44 2.88 2.92 2.75 2.85 2.6 2.79 1.84 2.52 2.38 3.01 2.2 2.45



Mutant Information


ChromosomeMutant PositionZFIN ID
chr13 33490467 la010231



Predicted Open Reading Frames


ORFRangeSequence
1. 165-293 MFPNQHEITADGKCGMSVDVHYRSLSLSNLCVAVSHSSTCVTR
2. 297-392 MVRHCAGVEMYNCSCTDIDLYYLLSYFVIFTP
3. 396-446 MFCVNNGCVIKQQCKIH
4. 412-465 MDALLNNNAKFIEPALSC
5. 434-514 MQNSLNLLCLVKTVPLICHIKKRKEQS
6. 691-732 MRKPVSWFINIRDY
7. 789-860 MKFRLLFSLQINSNISKRMCIDRF
8. 1093-1128 MRDCVGCVWQSY
9. 1186-1236 MPTIKKKKKKENKTGKR
10. 1251-1289 MASAASEALVKTN
11. 1385-1414 MVATAYRLLC
12. 1411-1506 MLKLDYKIDYVNQIAISVKTIAIRYFPQIAQP
13. 1583-1645 MGYESGHTQSEDIFCHFCTKI
14. 1590-1757 MSRAIHNLRTFFAIFAQKFEKIKIWRFLQKVNRLSDQLKICRFLCAQIPCGTSCWQ
15. 1757-1801 MNSFYVVNVTLYFLS
16. 1875-1946 MWCSLQSLKAQTVLVIKSNKVRCH
17. 1940-2002 MSLTLQILFSEIVHVHQQKTA
18. 1980-2030 MCISRKQHRLKDLNELK
19. 2020-2109 MSLNDVISMLSAKLLFLALSDLFQMSILCR
20. 2109-2150 MRPSCLCSSNRPSS
21. 2226-2261 MNISSLHFGEDN
22. 2324-2410 MTTQLCHNMVPSTGHIVQNKSNMVAVFVK
23. 2410-2442 MKIKMQKKMHI
24. 2456-2569 MQARRQSYIQQFYYLQIKCLDESLFNSSCLNFHGFALK
25. 2603-2758 MAENVVSETTNCRQLAVLLIHNSYWCFSKTMTHAFMFSTVYTCTDKPRQAVA
26. 2700-2777 MLSCFLQYILVLTNQDRQWHNNPKKT
27. 2840-2905 MKNSYFTTSEVTTAQSHTWIKL
28. 2913-2975 MLVFFVCSKINIVVIVCLMAW
29. 2983-3051 MRRGINFSFVCVKYRIETVCSPE
30. 3345-3374 MCNICFFVLF
31. 3310-3453 MRGRVARPQCGKCAIFVSLSCFEMNMYIVQTSDKLFAKTTKSPMSSIK
32. 3536-3580 MLAEFNSRSDIQYRL
33. 3706-3771 MKITFFCCCFFFNQDRDFLTIL
34. 3794-3847 MRRLLLLLLIFKYMVKQH
35. 3892-3945 MVDWFMSLTTLLENFFHW
36. 4021-4110 MLTFTCLCNNRPFDLNSFVEPFVLNSCLLW
37. 4098-4154 MPFMVTCCMFSDALVRVHI
38. 4427-4465 MCKYFFNNKGIMN
39. 4641-4691 MGHVTAFGGVHIAEQLA
40. 4783-4821 MCRVESRSRSFID
41. 4933-5028 MLRISKMAVGIDVRLAMLKCIYMFHKHCVSLS
42. 5047-5118 MKFWAQNSRLRSKRLSQIGQNLAQ
43. 5269-5454 MLSQTRAVGRLFLVAEHVDFNSTCRKLSGIKQLSKHCNVDKYLNDWNANYIFLNILEKICKP
44. 5445-5477 MQAMMCIKFIF
45. 5497-5556 MHELKYRNSLVVFVISVAYL
46. 5794-5829 MFIDSLLSLTAI
47. 5864-5932 MTHYPHEAWTNILPLYIYKPHLE
48. 5880-5984 MKPGQTFYHFTFTNPIWSKVFFKECKKNLMHGRNG
49. 5971-6081 MVEMDKKCFVLHAIIELCLKMFMQKCDDTKSMSGPVL
50. 6097-6162 MHGIPKLISTVNYSQTCSLRNV
51. 6217-6252 MQCFSKVLTIVS
52. 6278-6379 MFNANNIAEYKLICFADLICVADFASECETLCLV
53. 6370-6426 MLSLIYALQKRPAWFCTKY
54. 6386-6433 MHYRSVPHGFVQNIKF
55. 6408-6467 MVLYKILNFSNKKKQHGANH

Variant Information


Variant PositionrsIDReferenceAlternate
33484884 rs40658076 C T
33485577 rs180115626 A G
33487542 rs180115627 T C

References

lncRNA has been predicted by:

Ulitsky I, Shkumatava A, Jan CH, Sive H, Bartel DP
Conserved function of lincRNAs in vertebrate embryonic development despite rapid sequence evolution.
Cell(2011) 147: 1537-1550
PMID:22196729

Expression information has been derived from:

Retroviral insertion lines mapping to lncRNA loci has been derived from: